Os12g0583700

From RiceWiki
Revision as of 14:15, 28 December 2014 by Zhangye (talk | contribs) (Function)
Jump to: navigation, search

ZFP252 is a salt and drought stress responsive TFIIIA-type zinc finger protein gene in rice[1][2].

Annotated Information

Function

Agarwal et al. identified a total of 189 C2H2-type zinc finger proteins in the indica rice genome and found 26 genes that were upregulated by cold, drought or salt stress [3][4]. By gene expression analysis, Xu et al. identified several stress-related C2H2-type zinc finger proteins, such as ZFP182, ZFP252 and ZFP245, in japonica rice. Using gain- and loss-of-function strategies, Xu et al. found that overexpression of ZFP252 in rice increased tolerance to salt and drought stresses. The contents of free proline and soluble sugars in sense-ZFP252 transgenic rice plants were higher than those in the WT (wild-type) and antisense-ZFP252 transgenic rice plants under salt and drought stress. ZFP252 might play a key role in stress-responsive signal transduction pathway, and be useful in engineering crop plants with enhanced tolerance to salinity and drought stresses[1].

GO assignment(s): GO:0003676, GO:0005634, GO:0008270

Mutation

ZFP252 and Transgenic rice plants[1]: After salt treatment with 100 mM NaCl for 10 d when the top leaves of WT plants began to slightly roll, ZFP252-ox transgenic lines S3, S6, S7 and S10 accumulated more free proline and soluble sugars than WT and ZFP252-kd transgenic lines A14 and A17.After water withholding for 10 d when the top leaves of WT plants started to slightly roll, it was observed that the contents of free proline and soluble sugars in ZFP252-ox transgenic lines were also significantly higher than those in WT and ZFP252-kd lines.There was no significant difference in the contents of free proline and soluble sugars between WT, ZFP252-ox and ZFP252-kd transgenic lines before the drought stress.

Expression

Figure 1.Real-time PCR analysis of ZFP252.(from reference [2]).
Figure 2.ZFP252 conferred drought tolerance in rice.(from reference [1]).
Figure 3.Expression of stress-related genes in ZFP252 transgenic and WT rice.(from reference [1]).

1. Expression of ZFP252 in transgenic rice plants[1]: Both semi-quantitative RTPCR and quantitative real-time PCR showed that the expression level of ZFP252 in the four ZFP252-ox lines(S3, S6, S7 and S10) was significantly higher than that in WT plants. The expression of ZFP252 in two ZFP252-kd lines (A14 and A17) was hardly detected.

2. Overexpression of ZFP252 in rice seedlings enhanced plant tolerance to salinity.[1][2]

3. In mZFPs, the expression level of ZFP252 was enhanced under salt treatment but not under cold treatment (Figure 1). In mZFP+, the expression level of ZFP252 under normal conditions was equal to that of mZFP- as the insertion of mPing did not change the position of the TATA box or the Y Patch (Figure 1). In mZFP+, the expression level of ZFP252 was also increased only under salt stress, and its expression level was higher than that of mZFP-. The database search indicated that the REG of ZFP252 contained the auxinand salicylic acid-responsive cis-element ASF1MOTIFCAMV[2].

4. Overexpression of ZFP252 increases rice tolerance to drought stresses[1]: Almost all leaves of the WT and transgenic lines A14 and A17 rolled after 14 d of un-watered, while only a few of leaves of transgenic lines S3, S6, S7 and S10 rolled (Fig. 2A).The survival rates of lines S3, S6, S7 and S10 were 85.32%–90.32%, and significantly higher than those of WT plants(11.23%) and ZFP252-kd lines A14 (17.62%), A17 (15.32%)(Fig. 2B). It was found that the third leaves from top of WT and ZFP252-kd transgenic plants severely rolled after 10 d of water withholding and their relative electrolyte leakages were higher than those from ZFP252-ox (Fig. 2C). These results suggested that damage degree to the cell membrane of WT and ZFP252-kd transgenic plants was higher than that to the ZFP252-ox transgenic under drought stress.

5. Expression of stress-related genes in ZFP252 transgenic rice plants: Xu et al. analyzed the expression of several known stress-related genes in ZFP252 transgenic lines and WT, including OsDREB1A, Oslea3, OsP5CS and OsProT. There was no significant difference in the expression levels of Oslea3, OsP5CS and OsProT between ZFP252 transgenic lines and WT plants under non-treated conditions (Fig. 3B–D). However the OsDREB1A mRNA was much more accumulated in ZFP252-ox transgenic lines S3, S6, S7 and S10 as compared with that in ZFP252-kd lines A14, A17 or WT plants under normal conditions (Fig. 3A). Under salt or drought treatments the expression levels of all four stress-related genes in ZFP252-ox transgenic lines was increased more than that in ZFP252-kd lines and WT plants(Fig. 3A–D). It suggested that ZFP252 might be one upstream regulator of these genes mediating expression of some stress-related genes upon rice treated with salt or drought stresses. It acted as a master switch in stress tolerance, and was involved in the complicated network controlling stress responsive genes. OsDREB1A encoding a DREB protein in rice was responsive to overexpression of ZFP252 in ZFP252-ox plants, suggesting ZFP252 might be an upstream regulator of OsDREB1A.

PCR was performed with ZFP252-specific primers of 5'-GGTGGAGGCGGTTCTTGAGG-3' and 5'-CGTCGTAGTGGCATCGCTTGT-3'.

Evolution

Figure 4. phylogenetic tree analysis of amino acid sequences of ZFP179 with the other stress-responsive C2H2-type zinc finger proteins.(from reference [5]).

To investigate the evolutionary relationship among plant C2H2-type zinc finger proteins involved in stress responses, a phylogenetic tree was constructed using Neighbor–Joining method with the full-length amino acid sequences (Figure 4). The result revealed that ZFP179 was clustered with ZFP182, ZFP150 and ZAT12, whereas other stress responsive zinc finger proteins were categorized into another big branch[5].

Knowledge Extension

Figure 5. Schematic Presentation of the Signaling Relationships among the Genes Described in the Review.(from reference [6]).

Schematic Presentation of the Signaling Relationships among the Genes Described in this Review Yang et al. focuses mainly on the recent studies of genes that are involved in molecular or biochemical processes affecting drought tolerance and that have been used successfully in the genetic engineering of staple crop species such as rice, maize, wheat (Triticum aestivum), soybean, and canolafor improvement of drought tolerance(Figure 5). The movement of guard cells might be controlled through the actions of activation/inactivation by a specific pair of kinase–phosphatase[6]). The identification of commercial grade transgenes that enhance crop performance under both drought and optimal conditions is a lengthy, tedious, and expensive process. Nevertheless, the successful genetic engineering of canola and maize for improved drought tolerance as reviewed herein confirms that the approach is feasible(Figure 5)[6]).

==Labs working on this gene

  • State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, PR China
  • Graduate School of Agriculture, Kyoto University, Kitashirakawa, Sakyo-ku, Kyoto 606-8502, Japan
  • Genebank, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Xu D Q, Huang J, Guo S Q, et al. Overexpression of a TFIIIA-type zinc finger protein gene< i> ZFP252</i> enhances drought and salt tolerance in rice (< i> Oryza sativa</i> L.)[J]. FEBS letters, 2008, 582(7): 1037-1043.
  2. 2.0 2.1 2.2 2.3 Yasuda K, Ito M, Sugita T, et al. Utilization of transposable element mPing as a novel genetic tool for modification of the stress response in rice[J]. Molecular Breeding, 2013, 32(3): 505-516.
  3. Huang J, Sun S J, Xu D Q, et al. Increased tolerance of rice to cold, drought and oxidative stresses mediated by the overexpression of a gene that encodes the zinc finger protein ZFP245[J]. Biochemical and biophysical research communications, 2009, 389(3): 556-561.
  4. Agarwal P, Arora R, Ray S, et al. Genome-wide identification of C2H2 zinc-finger gene family in rice and their phylogeny and expression analysis[J]. Plant molecular biology, 2007, 65(4): 467-485.
  5. 5.0 5.1 Sun S J, Guo S Q, Yang X, et al. Functional analysis of a novel Cys2/His2-type zinc finger protein involved in salt tolerance in rice[J]. Journal of experimental botany, 2010: erq120.
  6. 6.0 6.1 6.2 Yang S, Vanderbeld B, Wan J, et al. Narrowing down the targets: towards successful genetic engineering of drought-tolerant crops[J]. Molecular Plant, 2010, 3(3): 469-490.

Structured Information

Gene Name

Os12g0583700

Description

Zinc finger, C2H2-type domain containing protein

Version

NM_001073680.1 GI:115489321 GeneID:4352653

Length

1004 bp

Definition

Oryza sativa Japonica Group Os12g0583700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:24441085..24442088

Sequence Coding Region

24441233..24441976

Expression

GEO Profiles:Os12g0583700

Genome Context

<gbrowseImage1> name=NC_008405:24441085..24442088 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:24441085..24442088 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggtggaggcggttcttgaggcgtcgagaagtagtagtgaggaggaggcggaggtgatcgtcacgcacggcggcggcggcggcggcggaggaggaggaggacaggtggaggggtgggggaagcggaagcggtcgcggcggcggcgaccgcagctgccgccctccgaggaggagtacctcgcgctctgcctcctcatgctggcgcgcgggcgacgcgacggcgacgacgtggcggcgtcggcgtcggcggcggcggcggcggtggagcaccggtgctccgtctgcggcaaggcgttcgcgtcctaccaggctctcggcggccacaaggccagccaccggaagccgccgccgcccgccatggtcgacgacgacgaggtggtggtggagacgaaaccggcggctatcgcgacgccgtcctcgtcggcgtcgggcgtctccggcggcggcggcgggagggcgcacgagtgcaacgtgtgcggcaaggcgttcccgacggggcaggcgctgggcggccacaagcgatgccactacgacggcacgatcggcagcgccgccggcgccggcgcgtccaagccggcggcgaagacgaccgtggcggtggcggcgagccggggcttcgacctcaacctgccggcgctgccggacgtcgccgccgccgccgaccagcggtgcgcggcggaggacgacgaggtgctcagccctctcgccttcaagaagcccaggctcatgatcccggcatag</cdnaseq>

Protein Sequence

<aaseq>MAVEAVLEASRSSSEEEAEVIVTHGGGGGGGGGGGQVEGWGKRK RSRRRRPQLPPSEEEYLALCLLMLARGRRDGDDVAASASAAAAAVEHRCSVCGKAFAS YQALGGHKASHRKPPPPAMVDDDEVVVETKPAAIATPSSSASGVSGGGGGRAHECNVC GKAFPTGQALGGHKRCHYDGTIGSAAGAGASKPAAKTTVAVAASRGFDLNLPALPDVA AAADQRCAAEDDEVLSPLAFKKPRLMIPA</aaseq>

Gene Sequence

<dnaseqindica>113..856#tctccttccatttttcttgtgcacttctctttcccttgcaagctcaagaaacccaattaattaagatagttgtgatcatctccaagcttagctaattaagctactagtggccatggcggtggaggcggttcttgaggcgtcgagaagtagtagtgaggaggaggcggaggtgatcgtcacgcacggcggcggcggcggcggcggaggaggaggaggacaggtggaggggtgggggaagcggaagcggtcgcggcggcggcgaccgcagctgccgccctccgaggaggagtacctcgcgctctgcctcctcatgctggcgcgcgggcgacgcgacggcgacgacgtggcggcgtcggcgtcggcggcggcggcggcggtggagcaccggtgctccgtctgcggcaaggcgttcgcgtcctaccaggctctcggcggccacaaggccagccaccggaagccgccgccgcccgccatggtcgacgacgacgaggtggtggtggagacgaaaccggcggctatcgcgacgccgtcctcgtcggcgtcgggcgtctccggcggcggcggcgggagggcgcacgagtgcaacgtgtgcggcaaggcgttcccgacggggcaggcgctgggcggccacaagcgatgccactacgacggcacgatcggcagcgccgccggcgccggcgcgtccaagccggcggcgaagacgaccgtggcggtggcggcgagccggggcttcgacctcaacctgccggcgctgccggacgtcgccgccgccgccgaccagcggtgcgcggcggaggacgacgaggtgctcagccctctcgccttcaagaagcccaggctcatgatcccggcatagctagccaagcccacaagatttgtttaattttagccataaaattccattaaattaaacccatagttttttctgttaattactttcttaatttggtgattagtcttaggaatgatgattagtttgtgtatatagccattgtttgttcatc</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0583700, RefSeq:Os12g0583700