Difference between revisions of "Os12g0123700"

From RiceWiki
Jump to: navigation, search
(Function)
(Labs working on this gene)
Line 22: Line 22:
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Please input related labs here.
 
Please input related labs here.
 +
National Key Laboratory for Rice Biology, Institute of
 +
Biotechnology, Zhejiang University, Hangzhou 310058,
 +
Zhejiang, China
  
 
==References==
 
==References==

Revision as of 11:36, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Os12g0123700 includes NAC Family Genes in Oryza sativa, NAC Family Genes has some functions such as Morphogenesis, the response to stress stimuli.

Analysis of NAC Family Genes.[[File:https://www.google.com.hk/url?sa=i&rct=j&q=&esrc=s&source=images&cd=&cad=rja&uact=8&docid=8w_3eG7oUYI6HM&tbnid=5CtRXASPkggi8M:&ved=0CAUQjRw&url=%68%74%74%70%3a%2f%2f%61%62%63%2e%63%62%69%2e%70%6b%75%2e%65%64%75%2e%63%6e%2f%73%65%6d%69%6e%61%72%2f%63%61%61%73%31%32%66%32%2d%30%37%2e%70%64%66&ei=4-WGU6mLLYbj8AWGhIG4Dg&psig=AFQjCNEzzXS5x8fHD_NoUgjl21YTng1Jew&ust=1401435980393481]] NAM are involved in shoot apical meristem formation and development. Functions of rice NAC transcriptional factors, ONAC122 and ONAC131, in defense responses against Magnaporthe grisea.

NAC (NAM/ATAF/CUC) transcription factors have important functions in regulating plant growth, development, and abiotic and biotic stress responses.ONAC131 have important roles in rice disease resistance responses through the regulated expression of other defense- and signaling-related genes.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. National Key Laboratory for Rice Biology, Institute of Biotechnology, Zhejiang University, Hangzhou 310058, Zhejiang, China

References

Please input cited references here. 1. Lijun Sun;Huijuan Zhang;Dayong Li;Lei Huang;Yongbo Hong;Xin Shun Ding;Richard S. Nelson;Xueping Zhou;Fengming Song

 Functions of rice NAC transcriptional factors, ONAC122 and ONAC131, in defense responses against Magnaporthe grisea
 Plant Molecular Biology, 2013, 81(1-2): 41-56

2.Ooka H, Satoh K, Doi K, Nagata T, Otomo Y, Murakami K,Matsubara K, Osato N, Kawai J, Carninci P, Hayashizaki Y,

 Suzuki K, Kojima K, Takahara Y, Yamamoto K, Kikuchi S (2003) Comprehensive analysis of NAC family genes in Oryza
 sativa and Arabidopsis thaliana. DNA Res 10:239–247

3.Ahn IP, Kim S, Kang S, Suh SC, Lee YH (2005) Rice defense mechanisms against Cochliobolus miyabeanus and Magnaporthe

 grisea are distinct. Phytopathology 95:1248–1255

Structured Information

Gene Name

Os12g0123700

Description

No apical meristem (NAM) protein domain containing protein

Version

NM_001072566.2 GI:297612570 GeneID:4351369

Length

2151 bp

Definition

Oryza sativa Japonica Group Os12g0123700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:1138157..1140307

Sequence Coding Region

1138361..1138532,1138660..1138982

Expression

GEO Profiles:Os12g0123700

Genome Context

<gbrowseImage1> name=NC_008405:1138157..1140307 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:1138157..1140307 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccatcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggcgctgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgcacgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcttgtcaactccgacgagcgacaacatcggcgtcaagaaggccctagtcttctacaagggcaagccccccaagggcgtcaagaccgactggatcatgcacgagtatcgcctcacaggcacatcagctaacaacaccaccaccacaaagcagcgtagagcatcatccatgaccatgagggtgagattcatttaa</cdnaseq>

Protein Sequence

<aaseq>MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASIKCPVPIIA EVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL STPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANNTTTTKQRRASSMTMR VRFI</aaseq>

Gene Sequence

<dnaseqindica>205..376#504..826#atttcaatccttcctcttccttagcttattagcttccttccttcactagtgccagttttcctcctacgtaatctaagctagccaggtcgtcatcttcttccttcagctcacgctgaccaaacaccatctgttattctgtttgtttgtttttttttaaaaaaagaaaaaaaatctagctaggcgagccgattgaaggagctgagcatgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccatcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaactaactaactaatcaccatacatatataaactatccatgtatcaattaaactcgatcaaattaatgccttcaaactgaccaaatttaattttgggctttgaaaatggatatggaatgttgcaggtaaggcgctgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgcacgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcttgtcaactccgacgagcgacaacatcggcgtcaagaaggccctagtcttctacaagggcaagccccccaagggcgtcaagaccgactggatcatgcacgagtatcgcctcacaggcacatcagctaacaacaccaccaccacaaagcagcgtagagcatcatccatgaccatgagggtgagattcatttaattacttaattttagttcattattaatttgtttttctcttcgtcgtacgtcttctttgaaagctacgtcgttgtttgaattggcatattgaaggaagcaaacgtgcatgttgctcttagttaactcactctacaaagtcaaatttgttgatgttgattgagcttgtgttttattctttattttaaaaataaataaagcaagtttgcacacttctaattattgtttactgcatttgtgatattgttcatcagctggacgactgggtgctgtgcagaatccacaagaagagcaacgacttcaattcctctgaccaacacgaccaagaacccgagggatcaaccgtcgatgaacagcttgaagacatccatgacaacaactcttcctctcaacaacctcctgctccacctgacatgaacaaccaacagtcagatttccagcccatgacggcgatgagcatgagcaagtcatgctccctcaccgatctcctcaacaacctcgactgcgccgcgctctcgcagtttctcctcgacggctcatccgacgccatcgctgagcttcctgctcctcccagccctctaatatatccaaaccaaacactaaactataacatcaacaacaacatgccacacgccttcgagtcacgcctagatcatcacgatggttacgttaacaattataatgttaatggcctaaggaggaagagaatgatggcgtgtagtgcaacttcttttgatgatggcagcagcagcagcagcagtgactttttgcatgttgccaagaaaccgctgctgctgccaagtgattcaaggggcagtggttttggaggaggttactgcaaccagcagctttcagagactgcgactggttttcagtttcagaacggcaatatgttgagccatccatttcctctgaaccagcagctactgctgaacaatcatctgcagatgcagtagctagtaggcgtctagatccgtttaccgatcgatctgaagagaggtgaattaatttcaacgaatgaaactacagattcagagaggaagatactgattgttccatttggatttattttgaggagttgcatgacagatagacaaacagacggaattcttgatgtaacccatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttgttttcattttcatgtacaagaatgtaaattataaatggtaatatcgtgcaagctagtactcaagccaatttatatgataatctttatgcatgtttcttaattattctggtatcaagcacacgaaagaaacatgctactttgtcgttgattc</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0123700, RefSeq:Os12g0123700