Difference between revisions of "Os12g0123200"
(Created page with "{{JaponicaGene|
GeneName = Os12g0123200|
Description = Glutathione S-transferase, N-terminal domain containing protein|
Version = NM_001072563.2 GI:297612568 GeneID:4351366...") |
|||
Line 1: | Line 1: | ||
+ | Please input one-sentence summary here. | ||
+ | |||
+ | ==Annotated Information== | ||
+ | ===Function=== | ||
+ | Please input function information here. | ||
+ | |||
+ | ===Expression=== | ||
+ | Please input expression information here. | ||
+ | |||
+ | ===Evolution=== | ||
+ | Please input evolution information here. | ||
+ | |||
+ | You can also add sub-section(s) at will. | ||
+ | |||
+ | ==Labs working on this gene== | ||
+ | Please input related labs here. | ||
+ | |||
+ | ==References== | ||
+ | Please input cited references here. | ||
+ | |||
+ | ==Structured Information== | ||
{{JaponicaGene| | {{JaponicaGene| | ||
GeneName = Os12g0123200| | GeneName = Os12g0123200| |
Revision as of 21:31, 22 July 2012
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
Gene Name |
Os12g0123200 |
---|---|
Description |
Glutathione S-transferase, N-terminal domain containing protein |
Version |
NM_001072563.2 GI:297612568 GeneID:4351366 |
Length |
967 bp |
Definition |
Oryza sativa Japonica Group Os12g0123200, complete gene. |
Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza. |
Chromosome | |
Location |
Chromosome 12:1096476..1097442 |
Sequence Coding Region |
1096611..1096919 |
Expression | |
Genome Context |
<gbrowseImage1> name=NC_008405:1096476..1097442 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1> |
Gene Structure |
<gbrowseImage2> name=NC_008405:1096476..1097442 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2> |
Coding Sequence |
<cdnaseq>ggtgtcaaagtgatgtgggcactaaggatcaaaggcgtggagtatgactacatcgaggaggatctgaggaacaagagcaacttgcttctggagtgcaaccccgtgcataagaaggtccccgtgctgatctatcaaggcaagccgattgctgaatcagacgtcatactggagttcatcgatgatgtctggaaggatttgagataccgtatcttgcctgaagatccctatgaatgtgccatggcacgtttctggtccaaatttgggctggacaaggtcagcaattttttttgtttattttctcaagtctaa</cdnaseq> |
Protein Sequence |
<aaseq>GVKVMWALRIKGVEYDYIEEDLRNKSNLLLECNPVHKKVPVLIY QGKPIAESDVILEFIDDVWKDLRYRILPEDPYECAMARFWSKFGLDKVSNFFCLFSQV </aaseq> |
Gene Sequence |
<dnaseqindica>136..444#aggtatctagtaccaaattgttcaaactgaaaccctcactcacaacattgctctgcagtcccaaccatggatcaccaagaactagaagatggagctgagaaggtgaagctgttaggcatatggtcaagcccttaaggtgtcaaagtgatgtgggcactaaggatcaaaggcgtggagtatgactacatcgaggaggatctgaggaacaagagcaacttgcttctggagtgcaaccccgtgcataagaaggtccccgtgctgatctatcaaggcaagccgattgctgaatcagacgtcatactggagttcatcgatgatgtctggaaggatttgagataccgtatcttgcctgaagatccctatgaatgtgccatggcacgtttctggtccaaatttgggctggacaaggtcagcaattttttttgtttattttctcaagtctaaacttttaagtaatcatttatccacaattgcagctgtcacctccaatttggaagtggttcaccacacaaggcaaggagcaggaggatgcatacgaagctgccatggagcagctgctggttctggaaaaggtgctcgatgagaagaaattctttggtggagagaggatcgggttcgtcgacttgtctctgggctccctgtcgtatgtgattccgatatatgaggacatcaccggtgtcaggctgatcaccagcgacaagttcccttggctgtctgcatggatggagggttttctgggcttgccactcgtgaaggaacatctgctgcctctggacaagctacggcccaggtatcaagcaattcgcgaagcatttttatctaaatagaagcagttggttagtagcagatgctgatatactgctctcttcaatgtttgtatatgtagcagttccacttcacactgctagactgctagtatttgttactactacatgagctacgatatatttttattatattgactcat</dnaseqindica> |
External Link(s) |