Difference between revisions of "Os08g0531600"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
[[File:Parental grains.jpg|frame|'''Figure1'''Parental grains. Scale bar, 3 mm.]]
+
[[File:Parental grains.jpg|frame|'''Figure1''' Parental grains. Scale bar, 3 mm.]]
  
 
'''''OsSPL16''''' control of grain size, shape, and quality<ref name="ref1" />.
 
'''''OsSPL16''''' control of grain size, shape, and quality<ref name="ref1" />.
Line 35: Line 35:
  
 
===Expression===
 
===Expression===
[[File: Expression of OsSPL16in NIL-GW8and NIL-gw8.jpg|frame|'''Figure2''' Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).]]
+
[[File: Expression of OsSPL16in NIL-GW8and NIL-gw8.jpg|frame|'''Figure2''' Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).]]
 
The expression profiles of OsSPL16in various organs of HJX74 were  examined  by  quantitative  RT-PCR  analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)<ref name="ref1 " />
 
The expression profiles of OsSPL16in various organs of HJX74 were  examined  by  quantitative  RT-PCR  analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)<ref name="ref1 " />
  

Revision as of 10:45, 10 May 2014

Os08g0531600(OsSPL16) is a very important gene that encoding a positive regulator of cell prolifertion which can pormote cell division and grain filling.

Annotated Information

Function

Figure1 Parental grains. Scale bar, 3 mm.

OsSPL16 control of grain size, shape, and quality[1]. OsSPL16 encodes a protein that is a positive regulator of cell proliferation. Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. The candidate gene 'OsSPL16' encodes squamosa promoter-binding protein-like 16, which belongs to the SBP domain family of transcription factors and shares homology with the product of tga1,a domestication syndrome gene associated with the formation of grains in maize[1]. Grain width and length were also altered in NIL-qw8 plaints expressing the Basmati385 OsSPL16 cDNA under the control of the native HJX74 promoter.







Mutation

A loss-of-function mutation in Basmati rice is assciated with the formation of a more slender grain and better quality of apperance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs[1].







Expression

Figure2 Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).

The expression profiles of OsSPL16in various organs of HJX74 were examined by quantitative RT-PCR analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)[1]






Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

<references>

Structured Information

Gene Name

Os08g0531600

Description

Similar to Squamosa-promoter binding-like protein 3

Version

NM_001068869.1 GI:115477476 GeneID:4346133

Length

5032 bp

Definition

Oryza sativa Japonica Group Os08g0531600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:26589172..26594203

Sequence Coding Region

26589228..26589718,26592621..26592751,26593194..26593939

Expression

GEO Profiles:Os08g0531600

Genome Context

<gbrowseImage1> name=NC_008401:26589172..26594203 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:26589172..26594203 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtag</cdnaseq>

Protein Sequence

<aaseq>MEWDLKMPPAASWELADELENSGGGGVPAAVSSSSAAVGGGVNA GGGGRQECSVDLKLGGLGEFGGGGAQPRVAVAGEPAKGKGPAAAATGAAAAASSAPAK RPRGAAAAGQQQCPSCAVDGCKEDLSKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQ QCSRFHLLQEFDEAKRSCRKRLDGHNRRRRKPQPDPMNSASYLASQQGARFSPFATPR PEASWTGMIKTEESPYYTHHQIPLGISSRQQHFVGSTSDGGRRFPFLQEGEISFGTGA GAGGVPMDQAAAAAAASVCQPLLKTVAPPPPPHGGGGSGGGKMFSDGGLTQVLDSDCA LSLLSAPANSTAIDVGGGRVVVQPTEHIPMAQPLISGLQFGGGGGSSAWFAARPHHQA ATGAAATAVVVSTAGFSCPVVESEQLNTVLSSNDNEMNYNGMFHVGGEGSSDGTSSSL PFSWQ</aaseq>

Gene Sequence

<dnaseqindica>57..547#3450..3580#4023..4768#acagctcaagcttacgcgggagctaagctgagctacagcgagcggcggcggcggccatggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtaaccccccccccccccccccaaccattgtctccttccttcccgccaaattcactgcaaaacaaaaaaaaaatcgtagcccaaaacaccccaagacgtcatggcaattcgcatcaagaactgcatatatcaatttctccacttcttttcagcgtcactgtctctgatcattctctttgctgaacaaaagaaaaagaagataagcaagagtttttctcttttttttgctccttttttttttggctttgcacaatctcttcttgcttccagttgcaactgaccattgtgcagtacatgcatctgcatctactgattctaatttctacgctacttcggatcaaaattaattcagtactgcaaagcacaatttcattgatccatttcatccagcctcggactttgttcatcatcatctatctgtctcttacttcctttccattgggagcatactatccggctgtctcgtttcagggacgcacagctttgcctttaatggcatgccttttcagccttccctcatgctatcctttagctcggcaactcgtattaccccaaattattacctctttgctcgcctttagatttattactatcatcttttcttttcttttttatatctcttcttcaccagtagctgcactgtttttgcactgctcaagagcaaagcagctgctgtagttgttcagtgtttgttgcttactgagaaaaaaaagtgatagagacagaaaaaaaagtgagggagagaaaaaaaaaaaaacagaactgacgcctgaatctcatcagccagagatcacattaggcaatttaccaccagactgttatgatattattttcagtgtcctcctgtctgaatatgaccgtctgcttcctctaacaagaacaataaatcagcacctagttcagtactaactaattttctcatgaataaataaataaatatagtcactgtaattagtgacactactagcacggtagcacctggtttagtggttaacaatacttggttcttgcacttctccctgtcgatgttttttcgcgtgggggctagctatcgattgattgattcctcaactatggcatcgaaactggaagaacatatgcatactgggacacacaccctgcttgctttctgaatttctgatttctcctcaaggcagctggcctaccacatatatctgactgagctgtgctgcttcttgccatgagagctaagctaccttagcttagctactactaccacttactacgccgtctgttttggaagggaaaggcagatgtggatgcccaaacctagaaagatggttgtaccactgaaagagagagtttgtggatgtgatctgcactaaagcacccctgtacagggaaaggaccatgtagccctactacaagttcaccatttacacctctgttcctaaggttgggccacacatatatgaagcttttaatgtctcggtttgttggaaagggttttgcattgccattacaagccagcacagtggatacagatagccagggtgctctctattggagaagaaaaaaaatggagccctgaacaccctgattggatctcactattgcatgaaagaatgatgagatttcttgtcttataatttttaaagattttttttctaaagtcagtcttagttacattcatttgttatattccagtttcagacttattggtactaggttctgtgagatctttttttttttttacatcgtttgagtatcatagggtgattcagtaccaccttgacccctgtttttatcagagctctaaacttctaacaccacttctaacttttgagctagtcttctaaccttgctgttttctgaacaaagatgtatactcaagattggtcatagatggagatattctgtgaacagaactaacataatagcaccaaattagtcagacatactctttacaaaattactttggagtttgttgtccactccttgaactagtacaatattgtcctactgaatgccttcctgcctttcaacttgaaagttccctattttatctgttagttcttttataaaatgtaactgcacattgtcagaaggatttgcatcttatttcactttgcgccagttttaagtaatacatggtatattggcataagaccagactctaccattttttatcttgcagagacatagcaaacaactaagtactttttattgtggtgtgctcctttacacagtagcacaacttgtaggatgcttatgtgattgtctcatcaattattctctttatctttaaaaagagaatgatacaaaaaatctctttatctgagaatacacattacccagtggggacagtctttcaatgatttgattacttcgtcagtgtttgcaaactgggaagatcattatgctgctgcatgcagactttataaattaagtgatcttcagagtcagaacaagatgttagctttctatacctatggatccacatccactgtattgtggtccatgtacaagtggggttaaaatatttttctgccgttgacagaacttcagttcaataaatttatctaagatgaagtatccaagcacggaaagagctaattaactgatgaaattcctgtggtcccttgtgttggtatatgagtattctaagagagaatatggagacagtatattaaattattctgagaatacttatcctgacgtttctttagtgagaactgtggtgcatcgttacaaaacttcagatcatgtttcaggagtattttatcatgtaagaattttaaaaagacgtacatcctaggtacagtcatttcttaaggtttcatggtactgaatgattaaattacttcttctggattgggtttcaagcatcatttggctaatttcaatgcagttaaatgatcataagcttttctttcttcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggtattttcttgtttattattaccactctatgatatcgcagttcatataagattaactgggatatagtcattcagacttcctaactattgttagactaggaaaaaaactatgaaacatgctaatagcatagataagtcatggtaaaaaaaaagtaaaagaaaatgaaactgtggttaaaaaaaaacgcaaatattagggaatgacctaatatcaaataattagaaggagtgaggcttcgaacccaggtcgtctagcccatcaccttttgaagctagccagaaaacccctgggcgtttctcagaactgtggttcagctatgactctgttctttcaatcctgacatcttgtaacatgtaatgcattctagtatacatctaatgcattgaaccatatcttatgtactaatttgtgctgatatatcaaacatcgcatcaaaattcaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtagttttttcagtaactgtatgttgctgccttagtttcagtagagttggttcttcatttcttttcagtgatcaaattattgtttctgttcttttctgccatggtaagttccttttttttttcttcttcttgccttcatttgagttaattacagcattgatttgtgtgaacaaaattcatcataaatcagttcctcgcgagatcattggtctcaacatgatggtgccaagtgagaactgcagtattgtgcagttttcagttttgagtc</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0531600, RefSeq:Os08g0531600

  1. 1.0 1.1 1.2 1.3 1.4 Wang S, Wu K, Yuan Q, et al. Control of grain size, shape and quality by OsSPL16 in rice[J]. Nature genetics, 2012, 44(8): 950-954.