Difference between revisions of "Os08g0139000"
Line 1: | Line 1: | ||
− | + | '''''OsDEG10''''' is a '''small RBP''' involved in the '''response to various abiotic stresses'''<ref name="ref1"/>. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
− | + | A rice small RBP, OsDEG10, might play important roles in the response to various abiotic stresses such as '''high light''', '''anoxia''', '''high salt''', '''cold''' and '''ROS stresses'''<ref name="ref1"/>. | |
+ | |||
+ | '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0000166 GO:0000166],[http://amigo.geneontology.org/amigo/term/GO:0003676 GO:0003676] | ||
+ | |||
+ | ===Mutation=== | ||
+ | OsDEG10 RNAi transgenic plants<ref name="ref1"/>: | ||
+ | *OsDEG10 RNAi plants showed '''more remarkable decline''' of '''Fv/Fm ratio''' than wild-type plants after '''high light treatment'''. | ||
+ | |||
+ | *OsDEG10 RNAi plants '''had lower xanthophyll pigment contents''' than wild-type plants, which suggest that OsDEG10 RNAi plants are '''more sensitive to high light''' than wild-type plants '''probably due to lower xanthophyll pigment pool size'''. | ||
+ | *OsDEG10 RNAi transgenic plants showed '''more decline of Fv/Fm ratio''' than wild type plants '''after cold treatment''', which suggest that OsDEG10 RNAi transgenic plants are '''more sensitive to cold stress''' and that OsDEG10 might play an important role in the '''response to cold stress''' as well as '''photooxidative stress'''. | ||
+ | *Under optimal growing conditions, no phenotypic variations between the OsDEG10 RNAi plants and wild-type plants were observed. | ||
+ | *Overall, OsDEG10 RNAi transgenic plants were '''more sensitive''' to '''high light and cold stresses''' compared to wildtype plants. | ||
===Expression=== | ===Expression=== | ||
− | + | Interestingly, the expression of OsDEG10, a small RBP group gene, '''increased under various abiotic stress conditions''' such as '''photooxidation''', '''anoxia''', '''osmotic''', '''ROS''' and '''cold stresses''', and OsDEG10 RNAi transgenic plants were sensitive to high light and cold stresses, which suggest that OsDEG10 is involved in the response to various abiotic stresses in rice<ref name="ref1"/>. | |
===Evolution=== | ===Evolution=== | ||
− | + | '''Protein motif''' and '''BlastP analysis''' results of OsDEG10 indicate that OsDEG10 '''belongs to small RBP group''', which is reported to include '''15 small RBPs''' in ''Arabidopsis''<ref name="ref1"/><ref name="ref2"/>. Rice OsDEG10 '''homologs''': Os07g36490 and Os03g17060, showing '''high similarity''' with OsDEG10 from database<ref name="ref1"/>. | |
+ | |||
+ | ===Knowledge Extension=== | ||
+ | *Excessive light can be harmful to photosynthetic apparatus since it causes photoinhibition and photooxidation, and plants often encounter hypoxic or anoxic environments when they become submerged by heavy rain or an ensuing flood<ref name="ref1"/>. | ||
− | + | *The ''Arabidopsis'' genome encodes 196 RRM-containing proteins, a more complex set than found in Caenorhabditis elegans and Drosophila melanogaster. In addition, the Arabidopsis genome contains 26 KH domain proteins. Most of the ''Arabidopsis'' RRM-containing proteins can be classified into structural and/or functional groups, based on similarity with either known metazoan or ''Arabidopsis'' proteins<ref name="ref2"/>. | |
+ | |||
+ | *Approximately 50% of ''Arabidopsis'' RRM-containing proteins do not have obvious homologues in metazoa, and for most of those that are predicted to be orthologues of metazoan proteins, no experimental data exist to confirm this. Additionally, the function of most ''Arabidopsis'' RRM proteins and of all KH proteins is unknown<ref name="ref2"/>. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
− | + | *Department of Biological Sciences, Pusan National University, San 30, Jangjeon-dong, Geumjeong-gu, Busan 609-735, Republic of Korea | |
+ | *National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea | ||
==References== | ==References== | ||
− | + | <references> | |
+ | * <ref name="ref1"> | ||
+ | Park H Y, Kang I S, Han J S, et al. OsDEG10 encoding a small RNA-binding protein is involved in abiotic stress signaling[J]. Biochemical and biophysical research communications, 2009, 380(3): 597-602. | ||
+ | </ref> | ||
+ | * <ref name="ref2"> | ||
+ | Lorković Z J, Barta A. Genome analysis: RNA recognition motif (RRM) and K homology (KH) domain RNA-binding proteins from the flowering plant Arabidopsis thaliana[J]. Nucleic acids research, 2002, 30(3): 623-635. | ||
+ | </ref> | ||
+ | </references> | ||
==Structured Information== | ==Structured Information== |
Revision as of 02:38, 24 March 2015
OsDEG10 is a small RBP involved in the response to various abiotic stresses[1].
Contents
Annotated Information
Function
A rice small RBP, OsDEG10, might play important roles in the response to various abiotic stresses such as high light, anoxia, high salt, cold and ROS stresses[1].
GO assignment(s): GO:0000166,GO:0003676
Mutation
OsDEG10 RNAi transgenic plants[1]:
- OsDEG10 RNAi plants showed more remarkable decline of Fv/Fm ratio than wild-type plants after high light treatment.
- OsDEG10 RNAi plants had lower xanthophyll pigment contents than wild-type plants, which suggest that OsDEG10 RNAi plants are more sensitive to high light than wild-type plants probably due to lower xanthophyll pigment pool size.
- OsDEG10 RNAi transgenic plants showed more decline of Fv/Fm ratio than wild type plants after cold treatment, which suggest that OsDEG10 RNAi transgenic plants are more sensitive to cold stress and that OsDEG10 might play an important role in the response to cold stress as well as photooxidative stress.
- Under optimal growing conditions, no phenotypic variations between the OsDEG10 RNAi plants and wild-type plants were observed.
- Overall, OsDEG10 RNAi transgenic plants were more sensitive to high light and cold stresses compared to wildtype plants.
Expression
Interestingly, the expression of OsDEG10, a small RBP group gene, increased under various abiotic stress conditions such as photooxidation, anoxia, osmotic, ROS and cold stresses, and OsDEG10 RNAi transgenic plants were sensitive to high light and cold stresses, which suggest that OsDEG10 is involved in the response to various abiotic stresses in rice[1].
Evolution
Protein motif and BlastP analysis results of OsDEG10 indicate that OsDEG10 belongs to small RBP group, which is reported to include 15 small RBPs in Arabidopsis[1][2]. Rice OsDEG10 homologs: Os07g36490 and Os03g17060, showing high similarity with OsDEG10 from database[1].
Knowledge Extension
- Excessive light can be harmful to photosynthetic apparatus since it causes photoinhibition and photooxidation, and plants often encounter hypoxic or anoxic environments when they become submerged by heavy rain or an ensuing flood[1].
- The Arabidopsis genome encodes 196 RRM-containing proteins, a more complex set than found in Caenorhabditis elegans and Drosophila melanogaster. In addition, the Arabidopsis genome contains 26 KH domain proteins. Most of the Arabidopsis RRM-containing proteins can be classified into structural and/or functional groups, based on similarity with either known metazoan or Arabidopsis proteins[2].
- Approximately 50% of Arabidopsis RRM-containing proteins do not have obvious homologues in metazoa, and for most of those that are predicted to be orthologues of metazoan proteins, no experimental data exist to confirm this. Additionally, the function of most Arabidopsis RRM proteins and of all KH proteins is unknown[2].
Labs working on this gene
- Department of Biological Sciences, Pusan National University, San 30, Jangjeon-dong, Geumjeong-gu, Busan 609-735, Republic of Korea
- National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Park H Y, Kang I S, Han J S, et al. OsDEG10 encoding a small RNA-binding protein is involved in abiotic stress signaling[J]. Biochemical and biophysical research communications, 2009, 380(3): 597-602.
- ↑ 2.0 2.1 2.2 Lorković Z J, Barta A. Genome analysis: RNA recognition motif (RRM) and K homology (KH) domain RNA-binding proteins from the flowering plant Arabidopsis thaliana[J]. Nucleic acids research, 2002, 30(3): 623-635.
Structured Information
Gene Name |
Os08g0139000 |
---|---|
Description |
Similar to RNA-binding glycine rich protein (RGP-2) |
Version |
NM_001067499.1 GI:115474734 GeneID:4344631 |
Length |
3319 bp |
Definition |
Oryza sativa Japonica Group Os08g0139000, complete gene. |
Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza. |
Chromosome | |
Location |
Chromosome 8:2172732..2176050 |
Sequence Coding Region |
2172986..2173111,2174690..2174796,2174883..2174951,2175889..2176012 |
Expression | |
Genome Context |
<gbrowseImage1> name=NC_008401:2172732..2176050 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
Gene Structure |
<gbrowseImage2> name=NC_008401:2172732..2176050 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
Coding Sequence |
<cdnaseq>atggcggcggcggctacggcgaggtccggattccggcgcatgttctccatctcggccttctccccgcccaagccgcccaccccgcccccgaaggccgacccctcccccaacctcttcatctcaggcttaagcaagcgtacaacaacagatgggcttaaagaagcttttgcaaagtttggggaagtcatacatgctcgagttgtcacagatcgtgtcactggattctctaaggggtttggcttcgtaaggtatgctacagttgaggatgcagctaaaggaatagaaggaatggatggaaagtttctcgatggatgggttatttttgctgaatatgctagacccagaacaccaccgcagcaaccagaaatgaactcacagccacaacaatcatggggccctccatccagttcctggggtgcacagtag</cdnaseq> |
Protein Sequence |
<aaseq>MAAAATARSGFRRMFSISAFSPPKPPTPPPKADPSPNLFISGLS KRTTTDGLKEAFAKFGEVIHARVVTDRVTGFSKGFGFVRYATVEDAAKGIEGMDGKFL DGWVIFAEYARPRTPPQQPEMNSQPQQSWGPPSSSWGAQ</aaseq> |
Gene Sequence |
<dnaseqindica>2940..3065#1255..1361#1100..1168#39..162#ctagcttctcacctcaccttcgaaatccggcggcggcgatggcggcggcggctacggcgaggtccggattccggcgcatgttctccatctcggccttctccccgcccaagccgcccaccccgcccccgaaggccgacccctcccccaacctcttcatctcaggtacgcctcactttctctctctctctccctcttcttgggcggcggccgtagaagtgctcccgttgcgttgccgtacccgattcggtcgtgtggatgatctaggatggcttaatttagaggatctcatggtggttgcacttttgggcggtcaaaagcaacattagagtatactagtatgtatatatatgttgttagtactaattcaatgtctgatggatttgggctgcttgattcgtatgagcaaaatcaggggagataagatcatatggtagtaagacatatagtggatactgatatgttgtgaagttagtataatcttttgatgtttctagatgtaactttatactgactgctcctctatatattagtttgttacttagtggaggatataggatataggacggatctaggacgccggtggaatgactgatgaaccagctgtacatcagcctaggttgaaagagacctattgctggatttgctggttcagattatgatagcaaacgtcgtacccctccaccttctgttcatggaacttgattcaattagttttacgaacaattgagtccatgcccaataagctcaggtcttcggcgttttccacacttgctgcttgcttgattctacatgctcgacacaaggaaattcactgcgggaactgaggaaatggacaatcacttaataaacattatttaaattttgtctacttatggtgctctgacctaaattccttatctgtagtgacaaaatgtgtgcaagctttctgagcttgtactccatattattatcggacctacttaaagctagcaccagttccctgttttaccgtcttacaatttaaagttcaataatgttgttccattttggatgcttccttgcatgttgagccttgttgcacacaatctctggactcccatcttagcatccttgtttgcaggcttaagcaagcgtacaacaacagatgggcttaaagaagcttttgcaaagtttggggaagtcatacatggtatgtttgcttaaaatgcagccattcctttcatcctttgtatttcaagacactgagttctatttcaatctgatttcaaattgcagctcgagttgtcacagatcgtgtcactggattctctaaggggtttggcttcgtaaggtatgctacagttgaggatgcagctaaaggaatagaaggaatggatggaaaggtatgtttcatactttcatatcatttttgttgttaggatttgttgttttttcctcaattctcttgtgttgaactctcactgtttatataatgatcagttcccatgatgcaataagcagaatatatgaccttacctctctacttgttatgcctcattttaaaaattttaatacaagaactgcctaatttcactggctgccactggaaaggcggaaacagtaagaaagctagttttgtattggagcataggcagttaatatatacacagaattgatttgattatgtggaattcagagaaagcaggacaagttggagaggtaggtagagcccagggagcctgcttaggcaccctttgtcaacagactatttcaaactaaatatgttgtagaattattcaggtatctcattttgacagtaccgaagtatagatatttgcatcctagttgaccagaaactgtgagcgtatgttcgttgtgcaatactatagtagtactatttaataacttggacatgctatggggtggacatcataggcatcacatttttctggacattttatcctgagattgaaattgagagcatcgtggtcactcaggtttactctttgtgttttgcacaagcagacagggcatgtgttaccacttttcaagttcatgtgtaagttttttttattatgatattggtagcacaatttgctaactacctaaggtctcaccacaattcaactctgatatattttgcacacattctttcttgttgtgctcatctctgaagaacaaaaatgcaaaaaaaaatgttcattattttaaaaataattatgtgtgaataatccagaattactatgtgcaagattcttaagaacacagatatcagcctcatgcactcatttcatatagcttgtattgtgctagatgctggatatcttgataaatttctgtggtaatttttaaggtatacgctaaccttttaatgctcaagtataatagttacattgttttcttacatgttatcgctgtgacttgtgacttgtgttgcttcgttgcaactggcaaatcatgaaccgtactcagacatgcttggactgatttcttcaacaaaaatcgtgaactggtggttctgcactgtctttagaatcttaatacaaatttgcattctggtatcttgtttttatttttgctttatatttagatactaaaatattttactctgtatgtttcctcattagcaatgatactccatatttttcttaattcattcttgaattcttgtggcaccaaagcaatacttcacacataatgtaagaaaattacgtatgtgatacactaactattgcccacatgaccctcatgctataatttatgctttcttgaatggctgagctctcaattatttatttattttttcagtctactaatttctaccatagtgaaaataaaatgaagcgtttatttggtgtggttagatactctgaaagcaactggtgaaaatatcattgaccattttgggcttctttttagagccttgctgcagtatatcataatgcacaggttttttctgatatatctctgcttctatgcagtttctcgatggatgggttatttttgctgaatatgctagacccagaacaccaccgcagcaaccagaaatgaactcacagccacaacaatcatggggccctccatccagttcctggggtgcacagtagatgaagatacaatcttggggccctctatctggccgtggggctcacagcggatcgacaagttattgattctatatttagtttatcgctataccatattgttccaggtgtgaacagagtttccgatccaatattcttatcgtgttggagtggtcgtttgcttgcatcccatggtttccgcatggagaagcacttgtcaaactgaatatggaccaaacaatattactatcaacgcgcaacaggacacgaacagcttc</dnaseqindica> |
External Link(s) |