Difference between revisions of "Os07g0628500"
| Line 1: | Line 1: | ||
| − | + | '''''OsbHLH1''''' is a '''unique-copy gene''' in rice<ref name="ref1"/>. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | OsbHLH1 had the '''ability to dimerize'''. OsbHLH1 may '''function as a transcription factor''' in a '''cold signal-transduction pathway'''. OsbHLH1 may not function in leaves but rather play roles in the cold responses of '''roots'''. OsbHLH1 protein had '''transcriptional activation activity'''<ref name="ref1"/>. | |
| + | |||
| + | '''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0030528 GO:0030528],[http://amigo.geneontology.org/amigo/term/GO:0005634 GO:0005634], GO:0045449 | ||
| + | |||
| + | ===Mutation=== | ||
| + | Four independent transgenic lines<ref name="ref2"/>: | ||
| + | *Two of them were further tested for their performance under low temperature. The results revealed that the transgenic plants had '''higher tolerance to low temperature''' when compared with the controls. | ||
===Expression=== | ===Expression=== | ||
| − | + | *The transcription of the OsbHLH1 gene was '''specifically induced''' in '''roots''' of rice '''seedlings''' by cold but not '''by NaCl''', '''PEG''' and '''ABA treatments'''<ref name="ref1"/>. | |
| + | |||
| + | *An increase of OsbHLH1 mRNA was already detectable in rice seedlings (shoots plus roots) after being exposed to cold (4°C) for 30 min. The expression reached the maximal level at 30 min after the initiation of the cold stress, and this level lasted around 5 h; thereafter, the OsbHLH1 expression was decreased<ref name="ref1"/>. | ||
| + | |||
| + | *OsbHLH1 gene, encoding a bHLH-type transcription factor, was '''induced under low temperature'''. PCR-amplification and Southern blot analysis confirmed that the OsbHLH1 gene was integrated into the ''Arabidopsis'' genome<ref name="ref2"/>. | ||
| + | |||
| + | ===Subcellular localization=== | ||
| + | OsbHLH1 was a '''nuclear protein''', possibly functioning as a transcription factor<ref name="ref1"/>. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | *The predicted OsbHLH1 has a '''putative DNA binding-domain bHLH-ZIP'''. The genomic sequence of the OsbHLH1 gene is '''unique''' in rice genome and has '''four introns'''. The OsbHLH1 was 1,137 bp in length with an open reading frame (ORF) of 798 bp flanked by a 120-bp 5'- untranslated region (UTR) and a 219-bp 3'-UTR. The open reading frame encoded a putative protein of 266 amino acids with a predicted molecular mass of 42 kDa<ref name="ref1"/>. | |
| + | |||
| + | *Several parts of one sequence shared '''99.9% identity''' with the '''nucleotide sequence''' of the OsbHLH1 gene<ref name="ref1"/>. | ||
| + | |||
| + | ===Knowledge Extension=== | ||
| + | *The basic Helix-Loop-Helix (bHLH) proteins are transcription factors that play important roles during the development of various metazoans including fly, nematode, and vertebrates. They are also involved in human diseases, particularly in cancerogenesis<ref name="ref3"/>. | ||
| − | + | *''Ledent et al.'' made an extensive search for bHLH sequences in the completely sequenced genomes ofCaenorhabditis elegans and of Drosophila melanogaster. We found 35 and 56 different genes, respectively, which may represent the complete set of bHLH of these organisms. A phylogenetic analysis of these genes, together with a large number (>350) of bHLH from other sources, led us to define 44 orthologous families among which 36 include bHLH from animals only, and two have representatives in both yeasts and animals<ref name="ref3"/>. | |
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | *Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, 100101 Beijing, PR China | |
| + | *College of Marine Life Sciences, Ocean University of China, 266003 Qingdao, PR China | ||
==References== | ==References== | ||
| − | + | <references> | |
| + | * <ref name="ref1"> | ||
| + | Wang Y J, Zhang Z G, He X J, et al. A rice transcription factor OsbHLH1 is involved in cold stress response[J]. Theoretical and Applied Genetics, 2003, 107(8): 1402-1409. | ||
| + | </ref> | ||
| + | * <ref name="ref2"> | ||
| + | Wang Y, Hao Y, Zhang J, et al. Improved tolerance of OsbHLH1 transgenic Arabidopsis to low temperature stress[J]. Gaojishu tongxun, 2003, 14(4): 35-38. | ||
| + | </ref> | ||
| + | * <ref name="ref3"> | ||
| + | Ledent V, Vervoort M. The basic helix-loop-helix protein family: comparative genomics and phylogenetic analysis[J]. Genome research, 2001, 11(5): 754-770. | ||
| + | </ref> | ||
| + | </references> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 13:17, 23 March 2015
OsbHLH1 is a unique-copy gene in rice[1].
Contents
Annotated Information
Function
OsbHLH1 had the ability to dimerize. OsbHLH1 may function as a transcription factor in a cold signal-transduction pathway. OsbHLH1 may not function in leaves but rather play roles in the cold responses of roots. OsbHLH1 protein had transcriptional activation activity[1].
GO assignment(s): GO:0030528,GO:0005634, GO:0045449
Mutation
Four independent transgenic lines[2]:
- Two of them were further tested for their performance under low temperature. The results revealed that the transgenic plants had higher tolerance to low temperature when compared with the controls.
Expression
- The transcription of the OsbHLH1 gene was specifically induced in roots of rice seedlings by cold but not by NaCl, PEG and ABA treatments[1].
- An increase of OsbHLH1 mRNA was already detectable in rice seedlings (shoots plus roots) after being exposed to cold (4°C) for 30 min. The expression reached the maximal level at 30 min after the initiation of the cold stress, and this level lasted around 5 h; thereafter, the OsbHLH1 expression was decreased[1].
- OsbHLH1 gene, encoding a bHLH-type transcription factor, was induced under low temperature. PCR-amplification and Southern blot analysis confirmed that the OsbHLH1 gene was integrated into the Arabidopsis genome[2].
Subcellular localization
OsbHLH1 was a nuclear protein, possibly functioning as a transcription factor[1].
Evolution
- The predicted OsbHLH1 has a putative DNA binding-domain bHLH-ZIP. The genomic sequence of the OsbHLH1 gene is unique in rice genome and has four introns. The OsbHLH1 was 1,137 bp in length with an open reading frame (ORF) of 798 bp flanked by a 120-bp 5'- untranslated region (UTR) and a 219-bp 3'-UTR. The open reading frame encoded a putative protein of 266 amino acids with a predicted molecular mass of 42 kDa[1].
- Several parts of one sequence shared 99.9% identity with the nucleotide sequence of the OsbHLH1 gene[1].
Knowledge Extension
- The basic Helix-Loop-Helix (bHLH) proteins are transcription factors that play important roles during the development of various metazoans including fly, nematode, and vertebrates. They are also involved in human diseases, particularly in cancerogenesis[3].
- Ledent et al. made an extensive search for bHLH sequences in the completely sequenced genomes ofCaenorhabditis elegans and of Drosophila melanogaster. We found 35 and 56 different genes, respectively, which may represent the complete set of bHLH of these organisms. A phylogenetic analysis of these genes, together with a large number (>350) of bHLH from other sources, led us to define 44 orthologous families among which 36 include bHLH from animals only, and two have representatives in both yeasts and animals[3].
Labs working on this gene
- Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, 100101 Beijing, PR China
- College of Marine Life Sciences, Ocean University of China, 266003 Qingdao, PR China
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Wang Y J, Zhang Z G, He X J, et al. A rice transcription factor OsbHLH1 is involved in cold stress response[J]. Theoretical and Applied Genetics, 2003, 107(8): 1402-1409.
- ↑ 2.0 2.1 Wang Y, Hao Y, Zhang J, et al. Improved tolerance of OsbHLH1 transgenic Arabidopsis to low temperature stress[J]. Gaojishu tongxun, 2003, 14(4): 35-38.
- ↑ 3.0 3.1 Ledent V, Vervoort M. The basic helix-loop-helix protein family: comparative genomics and phylogenetic analysis[J]. Genome research, 2001, 11(5): 754-770.
Structured Information
| Gene Name |
Os07g0628500 |
|---|---|
| Description |
Basic helix-loop-helix dimerisation region bHLH domain containing protein |
| Version |
NM_001066885.1 GI:115473502 GeneID:4343984 |
| Length |
2517 bp |
| Definition |
Oryza sativa Japonica Group Os07g0628500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:26699867..26702383 |
| Sequence Coding Region |
26700037..26700519,26700763..26700890,26701346..26701464,26701990..26702057 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:26699867..26702383 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:26699867..26702383 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggtgcccagggacagggtgaatgccgctgccgctggtggcggcggcgaggggaggctggtccagagcggtatagtgaacaagaagtgtgataagaaggctccaaagagaatccataaatcagagagggagaaacttaagcgggacaagcagaatgacctctttaatgagctgggaaacttgctagaacctgacaggcagaacaatgggaaggcatgtgtactgggtgaaactacacgaatactaaaagatttactttcacaagtggaatctctccggaaggagaatagttcactgaagaatgaatctcattatgttgcattggagagaaatgaactgcacgacgataacagcatgcttcgtactgaaatcttggagcttcaaaacgagcttaggacgcggatggaaggcaatcctgtttggagtcatgtaaacaccagaccagctctcagggtaccttatccgacaaccggagtgttcccagtacagcacctgccacatttaccagtcaccacgacggcagcatttcctcagcagctaccggttatcatcgagcagcactatgccgccacgccaagagaacttcagctcttccctgagtctgcgaccagcgaagacagcgaaccgtcacaagaacacgggatttctgaccatgtaacacggcctcagccaaggtacccaacaccaacggccactttgccagtaaacctgtttccagtgtttccaggaagacaagatcaacaatgtagcagtggtacttctggcactaacgaggaagaccgtataggtagatcttag</cdnaseq> |
| Protein Sequence |
<aaseq>MVPRDRVNAAAAGGGGEGRLVQSGIVNKKCDKKAPKRIHKSERE KLKRDKQNDLFNELGNLLEPDRQNNGKACVLGETTRILKDLLSQVESLRKENSSLKNE SHYVALERNELHDDNSMLRTEILELQNELRTRMEGNPVWSHVNTRPALRVPYPTTGVF PVQHLPHLPVTTTAAFPQQLPVIIEQHYAATPRELQLFPESATSEDSEPSQEHGISDH VTRPQPRYPTPTATLPVNLFPVFPGRQDQQCSSGTSGTNEEDRIGRS</aaseq> |
| Gene Sequence |
<dnaseqindica>1865..2347#1494..1621#920..1038#327..394#ggtggcgtccacgcgcccaccccacgcgcgtcaccgtcgctcgcccaaactgcgggcgcgtcgcacgccgccctcccatcgttttctcccattctttccccctcctcctcgtgcaaccacccaaccactgcagccagccacgagccgaggaagccgaggccgaggaggaagacgacgaagacaagtagcgcaaggaaccctcgaaccgggaggccgccgcggctccgatctgggaggtaaccggagctgcaccgcgcggtggggggaaattgaccagagtttgtttgattgatcgattgattgggaagtttcagggggaggtcgagatggtgcccagggacagggtgaatgccgctgccgctggtggcggcggcgaggggaggctggtccagaggtgagtcgttgttgctttcctaggggggcgtgtatggcttcgtcgctttgtgaggatgaggggggaaaaagtatgaactggatggattgggttgggttgctcttagctctcttggttttgggacgaagtggaaatttagtagtgtttttttttgacatattatgagttggttttatgagagacgtaaaccatgagatggaaataatgcttttaggccctgttgatgtgtatcatgtgcgtccaattttggagttggaggagcctaatttgagtttctgccatacagattaaagaattctcatattttaatttacgaacttaaaagccagatggataatgttgttgttgtgtttggaccatttatatttttgtagcactgcaaatttaattgctgcaatggggttaactaccagaactactacaaatcgaaaagcaattccttacttcatcttgaggtgttccatgaaggaatatttttgtccaaactgctttacaatcacactgatgtttgaactttctatgcagcggtatagtgaacaagaagtgtgataagaaggctccaaagagaatccataaatcagagagggagaaacttaagcgggacaagcagaatgacctctttaatgagctgggaaacttgctaggtatgtgtttgtttcgtaattgcgaatccataaacatgattcagattgcacaattgcattgcaacatttggatttttctttctgaaatatgcttatttatgtcattccatctagtgtacatactttcaatactgctagagacatccatttataatcttgtaggagtagtttgttcttatctattactaaattttaagatggatattacaaactctctggacgagttactactagaaatatagcagctgaaattgatttagcagtatttacattttcatctgccacaacctaacttttccctttacgtaaaatacaaaaaggaaaaaaaaagcagcagttatagtgagtgcaagtatcatttgtctaattaatttttagttgtctcagtttcaaaactgcatcgtttttgcatgcggaattatattttcctaagcaacgtgcaaactcctttccagaacctgacaggcagaacaatgggaaggcatgtgtactgggtgaaactacacgaatactaaaagatttactttcacaagtggaatctctccggaaggagaatagttcactgaagaatgaatctcattatgtaagctcttccgaattgaatgtcctatttgtcttcttgcaaaatattagctcaattgttctccttcaattaatttgatggccatggtctggttagtaataataccatggatatggaaaaatgtagagtagtacatatgatcatgataagagtttcttagaatagggctccaattatcattacttagaaaacaaagccaccttactactgattcataatcctactttccatgctgcaaaacaggttgcattggagagaaatgaactgcacgacgataacagcatgcttcgtactgaaatcttggagcttcaaaacgagcttaggacgcggatggaaggcaatcctgtttggagtcatgtaaacaccagaccagctctcagggtaccttatccgacaaccggagtgttcccagtacagcacctgccacatttaccagtcaccacgacggcagcatttcctcagcagctaccggttatcatcgagcagcactatgccgccacgccaagagaacttcagctcttccctgagtctgcgaccagcgaagacagcgaaccgtcacaagaacacgggatttctgaccatgtaacacggcctcagccaaggtacccaacaccaacggccactttgccagtaaacctgtttccagtgtttccaggaagacaagatcaacaatgtagcagtggtacttctggcactaacgaggaagaccgtataggtagatcttaggtacactacataacgagaggtccacacaatgatttgagaattcctttagtttcaacgtttaactttgcaagtttagcaaatgtgaaacagagatctgcgactgtgctcatgggtagcacctaatctgtatatctgaatctcagttttaagtggtcaaataggtgacattc</dnaseqindica> |
| External Link(s) |
