Os03g0856700

From RiceWiki
Revision as of 13:48, 21 May 2014 by Ibplimin (talk | contribs) (Evolution)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsGA20ox1, encoding an isoform of gibberellin 20-oxidase, for regulation of plant stature in rice. Gibberellin (GA) 20-oxidase (GA20ox) is a key enzyme that normally catalyzes the penultimate steps in GA biosynthesis[1].

Mutation

  • Figure 1 shows the gross morphology of the wild type and mutant plants. A mutant, B142, tagged with a T-DNA containing three CaMV 35S promoters showed a tall, GA-overproduction phenotype.The integrated T-DNAs, which contain three CaMV 35S promoters, are located upstream of the OsGA20ox1 open reading frame (ORF) in the B142 mutant genome. The final stature of the B142 mutant reflects internode overgrowth and is approximately twice that of its wild-type parent[1].
  • Figure 2 shows a typical phenotype of a rice GA deficient mutant at the young seedling stage. The GA-related mutants showed dwarfism without the induction of additionally aberrantmorphology. The final plant height of GA-deficient mutants ranged widely between \5% and 90% of the wild-type plants. The leaf blades of the mutant plants became dark green, shorter, and wider than those of the wild-type plants[2].

Expression

Semiquantitative reverse transcription (RT)-PCR analysis revealed that OsGA20ox1 were expressed at different levels in various organs of wild-type rice(Fig. 3)[2]. OsGA20ox1 were simultaneously expressed in all vegetative organs of rice, and all OsGA20ox genes were expressed in the reproductive organs. This overlap expression pattern, accompanied with the feedback up-regulation of other GA biosynthetic enzymes by the homeostatic system[3], compensate the defect in OsGA20ox2 function in shoot elongation, and consequently the defect in OsGA20ox2/SD1 induces suitable semidwarfism of the rice height for useful breeding.

Evolution

Figure 4 shows that phylogenetic analysis of 2ODDs (GA20ox, GA3ox, and GA2ox) revealed that the GA20ox proteins from dicot plants shared higher amino acid identity each other (49%–80% identities) and formed a single group. OsGA20ox2 showed higher similarity (61% identity) to OsGA20ox4 than the other OsGA20ox proteins, and OsGA20ox2 and OsGA20ox4 formed one subgroup (36%–48% identities with dicot proteins), whereas OsGA20ox1 and OsGA20ox3 were separately located from the OsGA20ox2/OsGA20ox4 subgroup (39%–54% and 39%–49% identities with dicot proteins, respectively)[2].

Knowledge Extension

The GAs form a large family of tetracyclic diterpenoid phytohormones that are involved in the regulation of various growth and developmental processes in higher plants. Bioactive GAs, such as GA1 and GA4,are synthesized from trans-geranylgeranyl diphosphate (GGDP) as shown in Figure 5[4].

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0856700

Description

Gibberellin 20 oxidase 1 (EC 1.14.11.-) (Gibberellin C-20 oxidase 1) (GA 20-oxidase 1) (Os20ox)

Version

NM_001058486.1 GI:115456700 GeneID:4334841

Length

1599 bp

Definition

Oryza sativa Japonica Group Os03g0856700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:37001546..37003144

Sequence Coding Region

37001714..37002832

Expression

GEO Profiles:Os03g0856700

Genome Context

<gbrowseImage1> name=NC_008396:37001546..37003144 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:37001546..37003144 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagcatggtggtgcagcaggagcaggaggtggtgttcgacgcggcggtgctgagcgggcagacggagatcccgtcgcagttcatatggccggcggaggagagccccgggtcggtggcggtggaggagctggaggtggcgctgatcgacgtgggggcgggggcggagaggtcgtcggtggtccggcaggtgggggaggcgtgcgagaggcacggcttcttcctggtggttaaccacggcatcgaggcggcgctgctggaggaggcgcaccggtgcatggacgccttcttcacgctgccgctgggggagaagcagcgggcgcagcggcgcgcgggggagagctgcggctacgccagcagcttcacggggcgcttcgcgtccaagctgccgtggaaggagacgctgtcgttccggtactcatcggctggagatgaagagggcgaggagggcgtgggtgagtacctggtgcggaagctcggggcggagcacgggcggcggctgggcgaggtgtactcgcgctactgccacgagatgagccgcctgtcgctggagctgatggaggtgctcggggagagcctgggcatcgtcggagaccggcgccactacttccggcgattcttccagcgcaacgactccatcatgcgcctcaactactacccggcgtgccagaggccactcgacacgctgggcaccggtccgcactgcgaccccacctcgctcaccatcctccaccaggaccacgtcggcggcctggaggtgtgggcggaggggcggtggcgcgccatccgccctcgccccggggcgctcgtcgtcaacgtcggcgacaccttcatggcgctctccaacgccaggtaccgcagctgcctgcaccgggcggtcgtcaacagcacggcgcctcgccgctcgctggccttcttcctctgcccggagatggacacggtggtgcgcccgccggaggagctggtcgacgaccaccacccgagggtgtacccggacttcacgtggcgggcgctgctggacttcacgcagcgccactacagggccgacatgcgcacgcttcaggccttctccgactggcttaatcatcatcgtcacctgcaaccaacaatatactcctag</cdnaseq>

Protein Sequence

<aaseq>MSMVVQQEQEVVFDAAVLSGQTEIPSQFIWPAEESPGSVAVEEL EVALIDVGAGAERSSVVRQVGEACERHGFFLVVNHGIEAALLEEAHRCMDAFFTLPLG EKQRAQRRAGESCGYASSFTGRFASKLPWKETLSFRYSSAGDEEGEEGVGEYLVRKLG AEHGRRLGEVYSRYCHEMSRLSLELMEVLGESLGIVGDRRHYFRRFFQRNDSIMRLNY YPACQRPLDTLGTGPHCDPTSLTILHQDHVGGLEVWAEGRWRAIRPRPGALVVNVGDT FMALSNARYRSCLHRAVVNSTAPRRSLAFFLCPEMDTVVRPPEELVDDHHPRVYPDFT WRALLDFTQRHYRADMRTLQAFSDWLNHHRHLQPTIYS</aaseq>

Gene Sequence

<dnaseqindica>169..1287#ggtcgatccagctgctggggatgagtacttagttagctcggagctagctactaatggatgatatacttatgctagttagttaaatacagttattagttagttgtaggttgcatctatcatatctccatcggttaattaattgattgatagctagattatcaacaattaatgagcatggtggtgcagcaggagcaggaggtggtgttcgacgcggcggtgctgagcgggcagacggagatcccgtcgcagttcatatggccggcggaggagagccccgggtcggtggcggtggaggagctggaggtggcgctgatcgacgtgggggcgggggcggagaggtcgtcggtggtccggcaggtgggggaggcgtgcgagaggcacggcttcttcctggtggttaaccacggcatcgaggcggcgctgctggaggaggcgcaccggtgcatggacgccttcttcacgctgccgctgggggagaagcagcgggcgcagcggcgcgcgggggagagctgcggctacgccagcagcttcacggggcgcttcgcgtccaagctgccgtggaaggagacgctgtcgttccggtactcatcggctggagatgaagagggcgaggagggcgtgggtgagtacctggtgcggaagctcggggcggagcacgggcggcggctgggcgaggtgtactcgcgctactgccacgagatgagccgcctgtcgctggagctgatggaggtgctcggggagagcctgggcatcgtcggagaccggcgccactacttccggcgattcttccagcgcaacgactccatcatgcgcctcaactactacccggcgtgccagaggccactcgacacgctgggcaccggtccgcactgcgaccccacctcgctcaccatcctccaccaggaccacgtcggcggcctggaggtgtgggcggaggggcggtggcgcgccatccgccctcgccccggggcgctcgtcgtcaacgtcggcgacaccttcatggcgctctccaacgccaggtaccgcagctgcctgcaccgggcggtcgtcaacagcacggcgcctcgccgctcgctggccttcttcctctgcccggagatggacacggtggtgcgcccgccggaggagctggtcgacgaccaccacccgagggtgtacccggacttcacgtggcgggcgctgctggacttcacgcagcgccactacagggccgacatgcgcacgcttcaggccttctccgactggcttaatcatcatcgtcacctgcaaccaacaatatactcctagctcctagtcctagctatatactcctattatccatccatccatccatcttacactactataccattagcatcgatcgatcatccattaattaattaattaattactagttccggcttagatatatatctggcgattatttcagttcctagctactcctacatgcatgctttgcttaattagatctatctatctaatctatcccggccggcctgttttaattccatatatcatttggtttgcacgtacccatctatgatctatatatacatgcatgtcgactattgttggtcgtacgatattatattatatata</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0856700, RefSeq:Os03g0856700

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. 2.0 2.1 2.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4