Difference between revisions of "Os03g0856700"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
'''''OsGA20ox1''''', encoding an isoform of gibberellin 20-oxidase, for regulation of plant stature in rice. Gibberellin (GA) 20-oxidase (GA20ox) is a key enzyme that normally catalyzes the penultimate steps in GA biosynthesis<ref name="ref1" />.
 
'''''OsGA20ox1''''', encoding an isoform of gibberellin 20-oxidase, for regulation of plant stature in rice. Gibberellin (GA) 20-oxidase (GA20ox) is a key enzyme that normally catalyzes the penultimate steps in GA biosynthesis<ref name="ref1" />.
 +
===Mutation===
 +
*Figure 1 shows the gross morphology of the wild type and mutant plants. A mutant, B142, tagged with a T-DNA containing three CaMV 35S promoters showed a tall, GA-overproduction phenotype.The integrated T-DNAs, which contain three CaMV 35S promoters, are located upstream of the OsGA20ox1 open reading frame (ORF) in the B142 mutant genome. The final stature of the B142 mutant reflects internode overgrowth and is approximately twice that of its wild-type parent<ref name="ref1" />.
 +
*Figure 2 shows a typical phenotype of a rice GA deficient mutant at the young seedling stage. The GA-related mutants showed dwarfism without the induction of additionally aberrantmorphology. The final plant height of GA-deficient mutants ranged widely between \5% and 90% of the wild-type plants. The leaf blades of the mutant plants became dark green, shorter, and wider than those of the wild-type plants<ref name="ref2" />.
  
 
===Expression===
 
===Expression===

Revision as of 13:35, 21 May 2014

Please input one-sentence summary here.

Annotated Information

Function

OsGA20ox1, encoding an isoform of gibberellin 20-oxidase, for regulation of plant stature in rice. Gibberellin (GA) 20-oxidase (GA20ox) is a key enzyme that normally catalyzes the penultimate steps in GA biosynthesis[1].

Mutation

  • Figure 1 shows the gross morphology of the wild type and mutant plants. A mutant, B142, tagged with a T-DNA containing three CaMV 35S promoters showed a tall, GA-overproduction phenotype.The integrated T-DNAs, which contain three CaMV 35S promoters, are located upstream of the OsGA20ox1 open reading frame (ORF) in the B142 mutant genome. The final stature of the B142 mutant reflects internode overgrowth and is approximately twice that of its wild-type parent[1].
  • Figure 2 shows a typical phenotype of a rice GA deficient mutant at the young seedling stage. The GA-related mutants showed dwarfism without the induction of additionally aberrantmorphology. The final plant height of GA-deficient mutants ranged widely between \5% and 90% of the wild-type plants. The leaf blades of the mutant plants became dark green, shorter, and wider than those of the wild-type plants[2].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0856700

Description

Gibberellin 20 oxidase 1 (EC 1.14.11.-) (Gibberellin C-20 oxidase 1) (GA 20-oxidase 1) (Os20ox)

Version

NM_001058486.1 GI:115456700 GeneID:4334841

Length

1599 bp

Definition

Oryza sativa Japonica Group Os03g0856700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:37001546..37003144

Sequence Coding Region

37001714..37002832

Expression

GEO Profiles:Os03g0856700

Genome Context

<gbrowseImage1> name=NC_008396:37001546..37003144 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:37001546..37003144 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagcatggtggtgcagcaggagcaggaggtggtgttcgacgcggcggtgctgagcgggcagacggagatcccgtcgcagttcatatggccggcggaggagagccccgggtcggtggcggtggaggagctggaggtggcgctgatcgacgtgggggcgggggcggagaggtcgtcggtggtccggcaggtgggggaggcgtgcgagaggcacggcttcttcctggtggttaaccacggcatcgaggcggcgctgctggaggaggcgcaccggtgcatggacgccttcttcacgctgccgctgggggagaagcagcgggcgcagcggcgcgcgggggagagctgcggctacgccagcagcttcacggggcgcttcgcgtccaagctgccgtggaaggagacgctgtcgttccggtactcatcggctggagatgaagagggcgaggagggcgtgggtgagtacctggtgcggaagctcggggcggagcacgggcggcggctgggcgaggtgtactcgcgctactgccacgagatgagccgcctgtcgctggagctgatggaggtgctcggggagagcctgggcatcgtcggagaccggcgccactacttccggcgattcttccagcgcaacgactccatcatgcgcctcaactactacccggcgtgccagaggccactcgacacgctgggcaccggtccgcactgcgaccccacctcgctcaccatcctccaccaggaccacgtcggcggcctggaggtgtgggcggaggggcggtggcgcgccatccgccctcgccccggggcgctcgtcgtcaacgtcggcgacaccttcatggcgctctccaacgccaggtaccgcagctgcctgcaccgggcggtcgtcaacagcacggcgcctcgccgctcgctggccttcttcctctgcccggagatggacacggtggtgcgcccgccggaggagctggtcgacgaccaccacccgagggtgtacccggacttcacgtggcgggcgctgctggacttcacgcagcgccactacagggccgacatgcgcacgcttcaggccttctccgactggcttaatcatcatcgtcacctgcaaccaacaatatactcctag</cdnaseq>

Protein Sequence

<aaseq>MSMVVQQEQEVVFDAAVLSGQTEIPSQFIWPAEESPGSVAVEEL EVALIDVGAGAERSSVVRQVGEACERHGFFLVVNHGIEAALLEEAHRCMDAFFTLPLG EKQRAQRRAGESCGYASSFTGRFASKLPWKETLSFRYSSAGDEEGEEGVGEYLVRKLG AEHGRRLGEVYSRYCHEMSRLSLELMEVLGESLGIVGDRRHYFRRFFQRNDSIMRLNY YPACQRPLDTLGTGPHCDPTSLTILHQDHVGGLEVWAEGRWRAIRPRPGALVVNVGDT FMALSNARYRSCLHRAVVNSTAPRRSLAFFLCPEMDTVVRPPEELVDDHHPRVYPDFT WRALLDFTQRHYRADMRTLQAFSDWLNHHRHLQPTIYS</aaseq>

Gene Sequence

<dnaseqindica>169..1287#ggtcgatccagctgctggggatgagtacttagttagctcggagctagctactaatggatgatatacttatgctagttagttaaatacagttattagttagttgtaggttgcatctatcatatctccatcggttaattaattgattgatagctagattatcaacaattaatgagcatggtggtgcagcaggagcaggaggtggtgttcgacgcggcggtgctgagcgggcagacggagatcccgtcgcagttcatatggccggcggaggagagccccgggtcggtggcggtggaggagctggaggtggcgctgatcgacgtgggggcgggggcggagaggtcgtcggtggtccggcaggtgggggaggcgtgcgagaggcacggcttcttcctggtggttaaccacggcatcgaggcggcgctgctggaggaggcgcaccggtgcatggacgccttcttcacgctgccgctgggggagaagcagcgggcgcagcggcgcgcgggggagagctgcggctacgccagcagcttcacggggcgcttcgcgtccaagctgccgtggaaggagacgctgtcgttccggtactcatcggctggagatgaagagggcgaggagggcgtgggtgagtacctggtgcggaagctcggggcggagcacgggcggcggctgggcgaggtgtactcgcgctactgccacgagatgagccgcctgtcgctggagctgatggaggtgctcggggagagcctgggcatcgtcggagaccggcgccactacttccggcgattcttccagcgcaacgactccatcatgcgcctcaactactacccggcgtgccagaggccactcgacacgctgggcaccggtccgcactgcgaccccacctcgctcaccatcctccaccaggaccacgtcggcggcctggaggtgtgggcggaggggcggtggcgcgccatccgccctcgccccggggcgctcgtcgtcaacgtcggcgacaccttcatggcgctctccaacgccaggtaccgcagctgcctgcaccgggcggtcgtcaacagcacggcgcctcgccgctcgctggccttcttcctctgcccggagatggacacggtggtgcgcccgccggaggagctggtcgacgaccaccacccgagggtgtacccggacttcacgtggcgggcgctgctggacttcacgcagcgccactacagggccgacatgcgcacgcttcaggccttctccgactggcttaatcatcatcgtcacctgcaaccaacaatatactcctagctcctagtcctagctatatactcctattatccatccatccatccatcttacactactataccattagcatcgatcgatcatccattaattaattaattaattactagttccggcttagatatatatctggcgattatttcagttcctagctactcctacatgcatgctttgcttaattagatctatctatctaatctatcccggccggcctgttttaattccatatatcatttggtttgcacgtacccatctatgatctatatatacatgcatgtcgactattgttggtcgtacgatattatattatatata</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0856700, RefSeq:Os03g0856700

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2