Difference between revisions of "Os03g0782500"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
Line 17: Line 17:
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Japan International Research Center for Agricultural Sciences, Tsukuba, Ibaraki 305-8686, Japan;
 
Japan International Research Center for Agricultural Sciences, Tsukuba, Ibaraki 305-8686, Japan;
 +
 
Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo 113-8657, Japan
 
Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo 113-8657, Japan
 +
 
Gene Function Research Center, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305-8562, Japan
 
Gene Function Research Center, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305-8562, Japan
 +
 
Plant Productivity Systems Research Group and Gene Discovery Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan
 
Plant Productivity Systems Research Group and Gene Discovery Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan
  

Revision as of 10:57, 21 May 2014

Please input one-sentence summary here.

Annotated Information

Function

This gene encodes a phytochrome-interacting factor-like protein named OsPIL1/OsPIL13. It acts as a key regulator of reduced internode elongation in rice under drought conditions. OsPIL1 downstream genes, which were enriched for cell wall-related genes responsible for cell elongation. OsPIL1 functions as a key regulatory factor of reduced plant height via cell wall-related genes in response to drought stress. This regulatory system may be important for morphological stress adaptation in rice under drought conditions.

Expression

The level of OsPIL1 mRNA in rice seedlings grown under nonstressed conditions with light/dark cycles oscillated in a circadian manner with peaks in the middle of the light period. Under drought stress conditions, OsPIL1 expression was inhibited during the light period. OsPIL1 was highly expressed in the node portions of the stem using promoter-glucuronidase analysis. Overexpression of OsPIL1 in transgenic rice plants promoted internode elongation. In contrast, transgenic rice plants with a chimeric repressor resulted in short internode sections.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Japan International Research Center for Agricultural Sciences, Tsukuba, Ibaraki 305-8686, Japan;

Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Tokyo 113-8657, Japan

Gene Function Research Center, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305-8562, Japan

Plant Productivity Systems Research Group and Gene Discovery Research Group, RIKEN Plant Science Center, Yokohama, Kanagawa 230-0045, Japan

References

1. Daisuke Todaka;Kazuo Nakashima;Kyonoshin Maruyama;Satoshi Kidokoro;Yuriko Osakabe;Yusuke Ito;Satoko Matsukura;Yasunari Fujita;Kyouko Yoshiwara;Masaru Ohme-Takagi;Mikiko Kojima;Hitoshi Sakakibara;Kazuo Shinozakie;Kazuko Yamaguchi-Shinozaki.Rice phytochrome-interacting factor-like protein OsPIL1 functions as a key regulator of internode elongation and induces a morphological response to drought stress.Proceedings of the National Academy of Sciences, 2012, 109(39): 15947-15952

2. Xiao-Ling Zhao;Zhen-Ying Shi;Ling-Tao Peng;Ge-Zhi Shen;Jing-Liu Zhang.An atypical HLH protein OsLF in rice regulates flowering time and interacts with OsPIL13 and OsPIL15.New Biotechnology, 2011, 28(6): 788-797

3. Yuko NAKAMURA;Takahiko KATO;Takafumi YAMASHINO;Masaya MURAKAMI;Takeshi MIZUNO.Characterization of a Set of Phytochrome-Interacting Factor-Like bHLH Proteins in Oryza sativa.Bioscience, Biotechnology, and Biochemistry, 2007, 71(5): 1183-1191

Structured Information

Gene Name

Os03g0782500

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001058000.1 GI:115455728 GeneID:4334324

Length

3289 bp

Definition

Oryza sativa Japonica Group Os03g0782500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:33283246..33286534

Sequence Coding Region

33283985..33284572,33284658..33284759,33284837..33284902,33285084..33285149,33285242..33285529
,33285610..33285732

Expression

GEO Profiles:Os03g0782500

Genome Context

<gbrowseImage1> name=NC_008396:33283246..33286534 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:33283246..33286534 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgatttgcagcacggacaacgagctggtggagctgctatggcacaacggcggcgtcgtggcgcagccgcaggcggcgcaggcgagggtcgtctcctcctccggccgcggccagagcgccagcgtgctcaccggcgacgacacggagaccgccgcgtggttcccggacaccctcgacgacgcgctggagaaggacctctacacgcagctctggcgcagcgtcaccggcgacgcgttcccggcggccgcggcggcggggccgagctctcaccacgctccgccgccggacttgccgcccccggcggcgaggccgccgatgaggagcggcatcgggtcgagctggaccggcgacatctgttcggccttctgcggcagcaaccacatcccggagacggcggcgcagcgctgccgggacgccggcgcggcattgccgccggagcggccgcgccggtcgagcacccacgacggcgccggcacgtcgtcgtcgggcggctccggcagcaacttcggcgcttccggcttgcccagcgagagcgccagtgcccacaagaggaaaggcagagaagattcagacagtcgcagtgaggatgctgaatgcgaggcaaccgaagagaccaaatcgtcgtcgcggcgatatggatcaaagaggagaactcgtgcagctgaagttcataacctgtcagagaggagaagaagggatcggatcaacgagaagatgcgcgcattgcaagaactcatacctcattgcaacaagaccgacaaggcatctatattagatgaagcaatcgagtatctgaagtcactccaaatgcaagttcagatcatgtggatgactactgggatggcaccaatgatgttccctggtgctcaccagttcatgccaccaatggccgtgggcatgaattctgcgtgcatgcctgcggcacaaggcctaagtcacatgtcaagattgccatacatgaaccattctatgccaaatcacatccctctaaattcatctccagctatgaacccaatgaatgttgcaaaccagatgcagaacattcaactgagagaggcaagcaatcccttccttcacccagatggctggcaaacagtgccaccacaggtatcaggaccatatgcttctgggcctcaagtagcacagcaaaaccagataccgaaagcgtcagctagcactgttctgccaaattctggggctgaacaaccaccaacctctgatggaatttag</cdnaseq>

Protein Sequence

<aaseq>MAICSTDNELVELLWHNGGVVAQPQAAQARVVSSSGRGQSASVL TGDDTETAAWFPDTLDDALEKDLYTQLWRSVTGDAFPAAAAAGPSSHHAPPPDLPPPA ARPPMRSGIGSSWTGDICSAFCGSNHIPETAAQRCRDAGAALPPERPRRSSTHDGAGT SSSGGSGSNFGASGLPSESASAHKRKGREDSDSRSEDAECEATEETKSSSRRYGSKRR TRAAEVHNLSERRRRDRINEKMRALQELIPHCNKTDKASILDEAIEYLKSLQMQVQIM WMTTGMAPMMFPGAHQFMPPMAVGMNSACMPAAQGLSHMSRLPYMNHSMPNHIPLNSS PAMNPMNVANQMQNIQLREASNPFLHPDGWQTVPPQVSGPYASGPQVAQQNQIPKASA STVLPNSGAEQPPTSDGI</aaseq>

Gene Sequence

<dnaseqindica>740..1327#1413..1514#1592..1657#1839..1904#1997..2284#2365..2487#gacgcagcccacgggccttgttcccttctcaccacctccaagtacgctttgcgggacactcgcggcagcaagagttcgtatactcgcctctgctgctgctgcactgccgcgcctaaagctgagcaagaagaggagactttgcagcaagagttgctactgtttggtttggttcaggtgagagaggtcaacaatagctgttggcgtggctagttgcttgtgcagaaaaggattctcttttggttttgccctttctgagaagctgatgatgatgtggtggtgggctatggttgtgcaggttggggagctactagaagaaggaggaatagctaggttgggtagctcagctttgctctccttttattttttatttttttttctgtttgttccaaggtttcttgcatcactttgcggcttatcttgttggttttccttctattttaaggtgtaaagtttgtctccttgtcttggttgtgcttgctgttcttgtttgtttcaaccaacttgtgcagttatacttgatgcttaatgcttctttttttttctttttctatgtggtttatgcaggttgtgaatttcttggggggacacaagaatcgtgggatggatggcaatgcgagatcggcggcgaatcagacgaagcaaatcgtgtagagatttcatctgaaacccaagaacggattcgtcttgtgttgttgccgaatggtagtgacctgacctgactctgtgtgcatttgctccaatggcgatttgcagcacggacaacgagctggtggagctgctatggcacaacggcggcgtcgtggcgcagccgcaggcggcgcaggcgagggtcgtctcctcctccggccgcggccagagcgccagcgtgctcaccggcgacgacacggagaccgccgcgtggttcccggacaccctcgacgacgcgctggagaaggacctctacacgcagctctggcgcagcgtcaccggcgacgcgttcccggcggccgcggcggcggggccgagctctcaccacgctccgccgccggacttgccgcccccggcggcgaggccgccgatgaggagcggcatcgggtcgagctggaccggcgacatctgttcggccttctgcggcagcaaccacatcccggagacggcggcgcagcgctgccgggacgccggcgcggcattgccgccggagcggccgcgccggtcgagcacccacgacggcgccggcacgtcgtcgtcgggcggctccggcagcaacttcggcgcttccggcttgcccagcgagagcgccagtgcccacaagaggaaaggcagagaagattcagacagtcgcagtgaggtgatcttttttttttcgttggctgtaacctgcaacttgctatgcttgagatgaattcttgaatgaaactgatgagaaatttcaggatgctgaatgcgaggcaaccgaagagaccaaatcgtcgtcgcggcgatatggatcaaagaggagaactcgtgcagctgaagttcataacctgtcagagagggtgagatcatcaaatacagctactgatcttaagagataaatttttagtagtcatcctaaaagatgatactgatgtagagaagaagggatcggatcaacgagaagatgcgcgcattgcaagaactcatacctcattgcaacaaggtaagaaacattattatatatgcatcttttttctgatcaggtgcaagtccatggactgatacagctatgttggtgagtggtggcatatctgatctatcctttgttgatatgattctcttttttattcaaaccttttgggtttactttactaactgcagttatctatatatttttcaattagaccgacaaggcatctatattagatgaagcaatcgagtatctgaagtcactccaaatgcaagttcaggtttgaactactgtttcttgtatctgaacttacatggtcctacatgaggccaattactagcacagattgagattgtcgaatctgtgcctcagatcatgtggatgactactgggatggcaccaatgatgttccctggtgctcaccagttcatgccaccaatggccgtgggcatgaattctgcgtgcatgcctgcggcacaaggcctaagtcacatgtcaagattgccatacatgaaccattctatgccaaatcacatccctctaaattcatctccagctatgaacccaatgaatgttgcaaaccagatgcagaacattcaactgagagaggcaagcaatcccttccttcacccagatggctggcaaacagtgccaccacaggtacaaaaataccatactgacaaagggaattttcaggcctctttgattgttcacctagattaggcattggtcatttgcaggtatcaggaccatatgcttctgggcctcaagtagcacagcaaaaccagataccgaaagcgtcagctagcactgttctgccaaattctggggctgaacaaccaccaacctctgatggaatttagaatgaccagaaacatgtaagcacttgcaccaatcagtacatctgcctatttacttcaaatgatgttgagataactagagctgcgtatcgctacttgtatgtattactattgttttcagccaatatatctgtattgaacacgatcggcaatttgtgccgtcactttttgtcagcttaagctttcagagcaactaggtaacatgaggacctatggacttacccatatcatctgtagtctgtttgttgagctcgaaatgcatgactagatgcatagaatatgaagccatcatcgtccagcttaaactttcacagtaacctgttagttcatgcaagctaaccagttgttttcatctgacctgtcatatgatggactagtcggtggctccaatctttttggtttttgacatcttctagcactgtccatgaaaattaacggttgtatgtctatttcagcgtcacgctgttgcatcaaatagaccacatgatagcaaagagttgctggtggataacttcagaactattatttatgatcttcattttcttgatattacaggataaggaattcaatgtaggctttgcacaaagggtcgtctttctggagatagctgaaaatattgacatgatgaacagattgcatccatattgctgttatgtatctcaatcagtatctgtctgacataaatgctacaagtgtctgtaaatgcacatagcatttccccccttccctaagatgctaattcccagtgtatgtactaataatccttataatatgaagtgccagtggcaatctttgcccttcttta</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0782500, RefSeq:Os03g0782500