Os03g0388600

From RiceWiki
Revision as of 12:41, 24 June 2012 by 127.0.0.1 (talk) (Created page with "{{JaponicaGene| GeneName = Os03g0388600| Description = Similar to Myb-like DNA-binding protein-like [Oryza sativa (japonica cultivar-group)]| Version = NM_001186522.1 GI:29...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gene Name

Os03g0388600

Description

Similar to Myb-like DNA-binding protein-like [Oryza sativa (japonica cultivar-group)]

Version

NM_001186522.1 GI:297722174 GeneID:9272330

Length

1606 bp

Definition

Oryza sativa Japonica Group Os03g0388600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:16063466..16065071

Sequence Coding Region

16064415..16064723

Expression

GEO Profiles:Os03g0388600

Genome Context

<gbrowseImage1> name=NC_008396:16063466..16065071 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:16063466..16065071 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcagctggaggtctctccccaagcgagccggtacatatgcatctacatatctttgctttaactagctgcttaattatatgttctttgtatttaattaaccatatatatgcagaaaaactcatgaaatttatacaatatatatgtgcagggctcaacaggtgctgcaagagctgccgtctgcgatggattaactatctcaggcctgacatcaagagaggcaacttcactcctgaggaagaacaggccatcattaccctccactccgtcctcggcaataagtatgtacatcaaaatttatcatcctag</cdnaseq>

Protein Sequence

<aaseq>MAAGGLSPSEPVHMHLHIFALTSCLIICSLYLINHIYAEKLMKF IQYICAGLNRCCKSCRLRWINYLRPDIKRGNFTPEEEQAIITLHSVLGNKYVHQNLSS </aaseq>

Gene Sequence

<dnaseqindica>349..657#attaaaattagggctgtggcgtgaccactgccagtcgatcgatcgtctgcctttataaactcacaaacaacagatgcatcaaacattcaaatcagcggatatagctagcagagcagcagtgcagggagcaaactgattaaccgacgatcgatcatatcgagagatcagcttcagcagctgggagagcaagcaaaagcgagagcagtatttgattcgtcagagagattgcaattagctcgatggggagactgaggccgccgtgctgcgacgagagcagcgtgaagaaggggccgtggacgcgggaggaggacgagaagctcgtcgcctacgtcgaccagcacggcggccatggcagctggaggtctctccccaagcgagccggtacatatgcatctacatatctttgctttaactagctgcttaattatatgttctttgtatttaattaaccatatatatgcagaaaaactcatgaaatttatacaatatatatgtgcagggctcaacaggtgctgcaagagctgccgtctgcgatggattaactatctcaggcctgacatcaagagaggcaacttcactcctgaggaagaacaggccatcattaccctccactccgtcctcggcaataagtatgtacatcaaaatttatcatcctagtaatagtgatacactcaatttagcttcctccaaaaaaaaaaacaacaacataacatctagatacgaatctagacattaaaattatgtcagaaacatacatacatcaatatatcggaatgatgtacaagacatatgtttcgtgcaccgaccagttaagtaacttatgtatgtccgtccacaggtggtcgaccatcgcgacacgccttcctgggcgcacggacaacgagatcaagaactactggaacacgcgcctcaagaagaggctcatcggcgccggcatcgacccggccacgcaccgcgcgcggccgcggccgccggcgcctggggacctcgccaccgcgctcccgcagctggtggcgctcgccagcctggccgtcgacctcgccgtcggccacgccgccgcagccggcggtgcgtggggcgccgccaacggcgccgtcgactaccagcaggccgacgcggcggcggcgcagctgcagtgcctccagcacctcctcctccagccacagacgacgccggccacctcggcgacgagcggcggcggcggccacccgaccgagctgaacgcggcgagcagcttcctgacccaagccgtcgcgtcctacgccgccgccgccgcgactcctctcccttctctcgtggtacccggtggtagccagcctctcgagctgaaacggtggcaagatcacatcggcggcgaccatgttggcgccgtgtcgcccttcgccggcgcggcgacggtgaccggccaccacggaggcggcggcggcggcggcggcgagtttctgccctcggagctgacggcgttgctgtgcagtgcgaacgccatcgatgatttgcaatccagtaatctagatttctgatgtaattagagcgtgagagtgtagaagattaagggtgtcgtaatcatcagacattaatcgagtcgacgtgttaattgttccgtagc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0388600, RefSeq:Os03g0388600