Difference between revisions of "Os03g0277000"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
'''''OsGDI3''''' functions as a '''negative regulator''' of ''OsMAPK2'' through '''modulating its kinase activity'''<ref name="ref1"/>.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*''OsGDI3'' '''facilitates''' the '''recycling''' of '''''OsRab11''''' with a help of '''''OsGAP1'''''. ''OsGDI3'' complement the yeast ''sec19-1'' mutant, a '''temperature-sensitive allele''' of the yeast GDI gene, suggesting that ''OsGDI3'' is a '''functional ortholog of yeast GDI'''<ref name="ref1"/>.
 +
 
 +
*''OsGDI3'' '''interacts with several OsRab proteins''', including '''''OsRab2''''', '''''OsRab5''''', '''''OsRab7''''' and '''''OsRab11'''''. ''OsGDI3'' '''negatively regulates''' the activity of ''OsMAPK2'', the autophosphorylation activity of ''OsMAPK2'' is inhibited by ''OsGDI3'' in vitro. SCR2 and/or SCR3 region in OsGDI3 is necessary for physical interaction with OsMAPK2 and inhibition of OsMAPK2 activity. ''OsGDI3'' can play a role in '''decreasing the MAPK activity''' in ''Arabidopsis''<ref name="ref1"/>.
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0005093 GO:0005093],[http://amigo.geneontology.org/amigo/term/GO:0015031 GO:0015031], [http://amigo.geneontology.org/amigo/term/GO:0043087 GO:0043087]
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
Ectopic expressions of ''OsGDI3'' in ''Arabidopsis'' cause '''reductions''' at the level of '''phosphorylated AtMPK''' in '''phosphorylation activity'''.
 
 
===Evolution===
 
Please input evolution information here.
 
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
*GDP dissociation inhibitor (GDI) plays an essential role in regulating the state of bound nucleotides and subcellular localizations of Rab proteins. An approximation of the three-dimensional structure of the Ga subunit has been developed on the basis ofthe crystal structure of the small, G protein Ras and ofelongation factor TU, another GTP binding protein<ref name="ref2"/>.
 +
*Ras ordinarily GTP very slowly. The rate of hydrolysis is accelerated by interaction with another protein called the GTPase activating protein(GAP)<ref name="ref2"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*Department of Molecular Biotechnology, Dong-A University, Busan 604-714, Republic of Korea
 +
*Division of Applied Life Sciences (BK21), Graduate School of Gyeongsang National University, Jinju 660-701, Republic of Korea
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Heo J B, Yi Y B, Bahk J D. Rice GDP dissociation inhibitor 3 inhibits OsMAPK2 activity through physical interaction[J]. Biochemical and biophysical research communications, 2011, 414(4): 814-819.
 +
</ref>
 +
* <ref name="ref2">
 +
Simon M I, Strathmann M P, Gautam N. Diversity of G proteins in signal transduction[J]. Science, 1991, 252(5007): 802-808.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 05:42, 12 March 2015

OsGDI3 functions as a negative regulator of OsMAPK2 through modulating its kinase activity[1].

Annotated Information

Function

  • OsGDI3 facilitates the recycling of OsRab11 with a help of OsGAP1. OsGDI3 complement the yeast sec19-1 mutant, a temperature-sensitive allele of the yeast GDI gene, suggesting that OsGDI3 is a functional ortholog of yeast GDI[1].
  • OsGDI3 interacts with several OsRab proteins, including OsRab2, OsRab5, OsRab7 and OsRab11. OsGDI3 negatively regulates the activity of OsMAPK2, the autophosphorylation activity of OsMAPK2 is inhibited by OsGDI3 in vitro. SCR2 and/or SCR3 region in OsGDI3 is necessary for physical interaction with OsMAPK2 and inhibition of OsMAPK2 activity. OsGDI3 can play a role in decreasing the MAPK activity in Arabidopsis[1].

GO assignment(s): GO:0005093,GO:0015031, GO:0043087

Expression

Ectopic expressions of OsGDI3 in Arabidopsis cause reductions at the level of phosphorylated AtMPK in phosphorylation activity.

Knowledge Extension

  • GDP dissociation inhibitor (GDI) plays an essential role in regulating the state of bound nucleotides and subcellular localizations of Rab proteins. An approximation of the three-dimensional structure of the Ga subunit has been developed on the basis ofthe crystal structure of the small, G protein Ras and ofelongation factor TU, another GTP binding protein[2].
  • Ras ordinarily GTP very slowly. The rate of hydrolysis is accelerated by interaction with another protein called the GTPase activating protein(GAP)[2].

Labs working on this gene

  • Department of Molecular Biotechnology, Dong-A University, Busan 604-714, Republic of Korea
  • Division of Applied Life Sciences (BK21), Graduate School of Gyeongsang National University, Jinju 660-701, Republic of Korea

References

  1. 1.0 1.1 1.2 Heo J B, Yi Y B, Bahk J D. Rice GDP dissociation inhibitor 3 inhibits OsMAPK2 activity through physical interaction[J]. Biochemical and biophysical research communications, 2011, 414(4): 814-819.
  2. 2.0 2.1 Simon M I, Strathmann M P, Gautam N. Diversity of G proteins in signal transduction[J]. Science, 1991, 252(5007): 802-808.

Structured Information

Gene Name

Os03g0277000

Description

Similar to GDP dissociation inhibitor protein OsGDI1

Version

NM_001056252.1 GI:115452232 GeneID:4332418

Length

3399 bp

Definition

Oryza sativa Japonica Group Os03g0277000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:9443012..9446410

Sequence Coding Region

9443172..9443231,9443340..9443414,9443491..9443701,9443836..9443960,9444049..9444150
,9444233..9444295,9444374..9444454,9444805..9444916,9445011..9445183
,9445279..9445386,9445466..9445549,9445688..9445750,9446209..9446295

Expression

GEO Profiles:Os03g0277000

Genome Context

<gbrowseImage1> name=NC_008396:9443012..9446410 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:9443012..9446410 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatgaggagtacgacgtgatcgtgctggggacggggctcaaggagtgcatcatcagcggcctcctctccgtcgatggcctcaaggtccttcacatggacaggaacgattactatggaggagaatctacatcccttaatctcactaagctctggaagagattcaaaggcaacgagaccgctcctgaacatctgggtgtcagcaaggagtacaatgttgacatggttcccaagttcatgatggccaacggtgcactggtccgtgtactcatccacacgagtgtgacaaagtatctgaatttcaaggctgtcgacggcagcttcgtgtacaacaatggcaagatccacaaagttcctgcaactgatgtcgaggccttgaaatctaatctaatgggcctttttgaaaagcgccgtgctaggaaattcttcatatacgtgcaggattacgaagaggatgatccaaagtcacacgaaggcctggatctgcacaaggtcacgacgagagaagtcatctccaagtatggcctcgaggatgacacagtggactttattgggcatgcattggcacttcatcgagatgataactatctcgatgaacctgcaattgacactgtgaaaaggatgaagctttacgcagaatcactcgctcgttttcaaggaggatcaccttatatctaccctctgtatgggctagcagagctccctcaggcctttgctcgtttgagtgctgtttatggtggcacatacatgctaaacaaagcagaatgcaaggttgagtttgatgaaaatgggaaagcatacggtgtcacttccgagggggagactgcaaaatgcaagaaggttgtctgtgacccttcatacttgcctgacaaggtgaagaaggttggaagggtggcgcgtgcaatatgcataatgaagcatccgattcctgacaccaaggattctcattccgtgcagatcatcctcccaaagaaacagctgaagcgcaaatcagacatgtacgtgttctgttgctcatatgctcacaacgttgcaccaaaaggcaagttcatcgcctttgtttctacggaagcagaggctgacaagcctgagatcgagctgaaacctgggatcgatctgctcggacctgtagaggaaacattttttgacatctatgaccgatacgaacctactaataccgctgacgaggacaactgcttcgtgacaaatagttacgatgcaactactcattttgagacaacggtgaaggatgtgcttgcattgtacagcaagatcactgggaaggaacttgatctttctgtggatctgaatgctgctagtgctgctgaatctgaagcggcctga</cdnaseq>

Protein Sequence

<aaseq>MDEEYDVIVLGTGLKECIISGLLSVDGLKVLHMDRNDYYGGEST SLNLTKLWKRFKGNETAPEHLGVSKEYNVDMVPKFMMANGALVRVLIHTSVTKYLNFK AVDGSFVYNNGKIHKVPATDVEALKSNLMGLFEKRRARKFFIYVQDYEEDDPKSHEGL DLHKVTTREVISKYGLEDDTVDFIGHALALHRDDNYLDEPAIDTVKRMKLYAESLARF QGGSPYIYPLYGLAELPQAFARLSAVYGGTYMLNKAECKVEFDENGKAYGVTSEGETA KCKKVVCDPSYLPDKVKKVGRVARAICIMKHPIPDTKDSHSVQIILPKKQLKRKSDMY VFCCSYAHNVAPKGKFIAFVSTEAEADKPEIELKPGIDLLGPVEETFFDIYDRYEPTN TADEDNCFVTNSYDATTHFETTVKDVLALYSKITGKELDLSVDLNAASAAESEAA</aaseq>

Gene Sequence

<dnaseqindica>3180..3239#2997..3071#2710..2920#2451..2575#2261..2362#2116..2178#1957..2037#1495..1606#1228..1400#1025..1132#862..945#661..723#116..202#gaacgcccagcgagcggaggagaggagaggagatcagggggaggaagggtggccggcgcagcagatcggggcgggcggatttaggggaggagcgcgctagccgggagcggcggcgatggatgaggagtacgacgtgatcgtgctggggacggggctcaaggagtgcatcatcagcggcctcctctccgtcgatggcctcaaggtgaccgaatcccatctccaatctctcgaatgcaccctctgattgcaactcgacaatgcgttctactgctgctggtgcgtgcgtccgcattagtagatctcacggtgctgaaagtgagattttgtttcgtgctgctggaaaatttggatggttttacgcgtacgaatgtgaaatgtgtacctagactggatggcattgctgttgttcaggaacacaaatggcaagatcagagaaatattaggatttgctttctttctctttaaagaagaaaaactcgcacatatcttctacagattctcaacataaatctcgaccccagttaaaattataaaaaaaatggaatgatctcataagatcctactagtatattttagtggctgcccttttagacaaaaggaacaatgtacagttgtacactatcaagtcactgtttttgtctcgttcttgtgtatatacaggtccttcacatggacaggaacgattactatggaggagaatctacatcccttaatctcactaaggtgtgataacgtgatcatcttgccaacatttctttctctgtgcagtatataggaagaactgcaaagaccatgtaattttttcagcaaatctgatgttgtgttatctaatatttttctccgttcatatgatatgtatagctctggaagagattcaaaggcaacgagaccgctcctgaacatctgggtgtcagcaaggagtacaatgttgacatggttcccaaggtccgtcatcactggagcgttctctatcttccctgaatttttgcttacacgcaacttgctacaaattattcgtctgcagttcatgatggccaacggtgcactggtccgtgtactcatccacacgagtgtgacaaagtatctgaatttcaaggctgtcgacggcagcttcgtgtacaacaatggcaaggtgtggatctgatattcatatgttatgcaactgtcaaacattggtgcattttctgaattactgagtcacctttatttgtttggcgataccgacagatccacaaagttcctgcaactgatgtcgaggccttgaaatctaatctaatgggcctttttgaaaagcgccgtgctaggaaattcttcatatacgtgcaggattacgaagaggatgatccaaagtcacacgaaggcctggatctgcacaaggtcacgacgagagaagtcatctcgtaagttgactaagttgctgactgttaacaaacagaaaacaagttgtattttgccaccatttcttatgcaggcgttatgatgtttgcttgtcagcaagtatggcctcgaggatgacacagtggactttattgggcatgcattggcacttcatcgagatgataactatctcgatgaacctgcaattgacactgtgaaaaggatgaaggtactatatgccccctaactcaagaaaacatttgagtctgcgtatattctgctcactgttgaaaacaacgatgctttgatcaattctctatgcaccacaactatatagtcaaaaaaaatccgagtgttatgcacttatgctgttgatttagttaatggttagttgttcttaacctcgtggccagatgaagtgattgggtgcccttatgataatgttcagtctattttatggaataaaaaatatatgattccacatggcagatgattgcaaatatatcatcagcttatattgccgtgcatgtggaaggtggaattaacatccgatcctcacatttgtatctgtttcaatagctttacgcagaatcactcgctcgttttcaaggaggatcaccttatatctaccctctgtatgggctagcagagctccctcaggtatgctcagttcaaataatctggattctccacacagcttcagcttcattccagctgaaactctgcatattgtaataggcctttgctcgtttgagtgctgtttatggtggcacatacatgctaaacaaagcagaatgcaaggtaaccgaagcattgctcagatgctactttggtactttccaactatccagatgaatgcttataattctacggtcgttggcaggttgagtttgatgaaaatgggaaagcatacggtgtcacttccgagggggagactgcaaaatgcaagaaggttgtctgtgacccttcatacttgcctgacaaggtatttataccatttagactcattttgagatattcaggttcaatttatggtagtatatctacttaaattcctgtcaacaaatgaacaggtgaagaaggttggaagggtggcgcgtgcaatatgcataatgaagcatccgattcctgacaccaaggattctcattccgtgcagatcatcctcccaaagaaacagctgaagcgcaaatcagacatgtaagcaatttactcgtccctcagttcttgctgcaacgacagccatcaaagtctattgctccatttctgagaacttatagcgttcagatattgcataattcacactattgcatatgtttcatgtttggtttcaggtacgtgttctgttgctcatatgctcacaacgttgcaccaaaaggcaagttcatcgcctttgtttctacggaagcagaggctgacaagcctgagatcgagctgaaacctgggatcgatctgctcggacctgtagaggaaacattttttgacatctatgaccgatacgaacctactaataccgctgacgaggacaactgcttcgtgacaaatgtaagttcagcaaatcagcaatttctctactcggccacactgcagtattgttgatgagcaccttcggttcttacagagttacgatgcaactactcattttgagacaacggtgaaggatgtgcttgcattgtacagcaagatcactgggaaggtaatcacatgaaaaatattaccaagttcaatacagaagcatactactattagatcaagcatgcgtttagttgaaattttttgtaacagcttgcacttatcaatgcaggaacttgatctttctgtggatctgaatgctgctagtgctgctgaatctgaagcggcctgagcgatagctacttcttccaattccttttattctttcatagatggatctgttcaattaaactacttcttgctattccagttccatttgaccttactgaaacaaagtacagtatcacggatttatatataattaaataatcttcatatattcttgcctgcat</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0277000, RefSeq:Os03g0277000