Difference between revisions of "Os03g0262900"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 4: Line 4:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Seeds of ''glup6'', which belongs to the same class as the ''glup4/rab5'' mutant, exhibit a protein pattern similar to ''glup4'' in having elevated proglutelin levels and reduced levels of acidic and basic glutelin subunits, prolamines, and 26-kD a-globulin<ref name="ref1" />. The GDP/GTP recycling of GLUP4/Rab5 by GLUP6/GEF is a key regulatory process in the trafficking of storage proteins to the protein storage vacuoles (PSVs)and in the general maintenance of the endomembrane system in developing rice endosperm<ref name="ref2" />.
+
The ''GLUP6'' candidate belonged to a gene family containing the Vps9 domain and was classified as a GEF for the Rab5 group. The ''GLUP6'' gene was expressed throughout plant development. Seeds of ''glup6'', which belongs to the same class as the ''glup4/rab5'' mutant, exhibit a protein pattern similar to ''glup4'' in having elevated proglutelin levels and reduced levels of acidic and basic glutelin subunits, prolamines, and 26-kD a-globulin<ref name="ref1" />. The GDP/GTP recycling of GLUP4/Rab5 by GLUP6/GEF is a key regulatory process in the trafficking of storage proteins to the protein storage vacuoles (PSVs)and in the general maintenance of the endomembrane system in developing rice endosperm<ref name="ref2" />.
 +
 
 +
===Wild Type VS. Mutant===
 +
*The ''glup6'' mutant accumulates large amounts of proglutelin<ref name="ref2" />. Figure 1A shows the profiles of total seed protein samples from three independent ''glup6'' mutant lines, EM939, EM1327, and EM1484, as well as from the wildtype. All three ''glup6'' lines contained elevated amounts of the 57-kD proglutelin polypeptide compared with the wild type. The change in the proglutelin levels between the wild type and the ''glup6'' mutants was readily discernible by immunoblot analysis (Fig. 1B). Figure 1C shows that the grain morphology is also significantly altered in the ''glup6'' mutants. All three mutant lines exhibited a floury endosperm.
 +
*Immunoblot analysis using an antibody raised against GLUP6/GEF revealed two reacting polypeptide bands in developing wild-type seeds with the bottom band missing in all ''glup6'' lines (Fig. 2). The theoretical molecular mass of GLUP6/GEF is 53.8 kD, a value in close agreement with the measured molecular size of the bottom polypeptide band. The ubiquitous presence of the top polypeptide band in Figure 2 may be due to
 +
another GEF-related protein. As all ''glup6'' lines contain nonsense mutations, even one close to the C terminus(EM1327), the lack of accumulated truncated polypeptides indicates that the polypeptide and the mRNA are unstable, the latter macromolecule likely degraded by nonsense-mediated mRNA decay.
  
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
 
+
The full-length open reading frame of Os03g0262900 was amplified with gene-specificprimers usingcomplementary DNA (cDNA) reverse transcribed from mRNA extracted from the immature seeds of the wild-type Taichung65 as a template. Sequencing analysis of the amplified single band demonstrated that the ''GLUP6'' candidate gene possessed a coding sequence of 1,443 bp coding for 480 deduced amino acids spanning over five exons<ref name="ref1" />.
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.

Revision as of 09:47, 15 May 2014

The rice glup6 plays a crucial role in the same pathway responsible for the intracellular transport of proglutelins from the Golgi to the protein storage vacuoles(PSVs) as glup4[1].


Annotated Information

Function

The GLUP6 candidate belonged to a gene family containing the Vps9 domain and was classified as a GEF for the Rab5 group. The GLUP6 gene was expressed throughout plant development. Seeds of glup6, which belongs to the same class as the glup4/rab5 mutant, exhibit a protein pattern similar to glup4 in having elevated proglutelin levels and reduced levels of acidic and basic glutelin subunits, prolamines, and 26-kD a-globulin[1]. The GDP/GTP recycling of GLUP4/Rab5 by GLUP6/GEF is a key regulatory process in the trafficking of storage proteins to the protein storage vacuoles (PSVs)and in the general maintenance of the endomembrane system in developing rice endosperm[2].

Wild Type VS. Mutant

  • The glup6 mutant accumulates large amounts of proglutelin[2]. Figure 1A shows the profiles of total seed protein samples from three independent glup6 mutant lines, EM939, EM1327, and EM1484, as well as from the wildtype. All three glup6 lines contained elevated amounts of the 57-kD proglutelin polypeptide compared with the wild type. The change in the proglutelin levels between the wild type and the glup6 mutants was readily discernible by immunoblot analysis (Fig. 1B). Figure 1C shows that the grain morphology is also significantly altered in the glup6 mutants. All three mutant lines exhibited a floury endosperm.
  • Immunoblot analysis using an antibody raised against GLUP6/GEF revealed two reacting polypeptide bands in developing wild-type seeds with the bottom band missing in all glup6 lines (Fig. 2). The theoretical molecular mass of GLUP6/GEF is 53.8 kD, a value in close agreement with the measured molecular size of the bottom polypeptide band. The ubiquitous presence of the top polypeptide band in Figure 2 may be due to

another GEF-related protein. As all glup6 lines contain nonsense mutations, even one close to the C terminus(EM1327), the lack of accumulated truncated polypeptides indicates that the polypeptide and the mRNA are unstable, the latter macromolecule likely degraded by nonsense-mediated mRNA decay.

Expression

Please input expression information here. The full-length open reading frame of Os03g0262900 was amplified with gene-specificprimers usingcomplementary DNA (cDNA) reverse transcribed from mRNA extracted from the immature seeds of the wild-type Taichung65 as a template. Sequencing analysis of the amplified single band demonstrated that the GLUP6 candidate gene possessed a coding sequence of 1,443 bp coding for 480 deduced amino acids spanning over five exons[1].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • Faculty of Agriculture, Kyushu University, Fukuoka 812–8581, Japan
  • National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305–8602, Japan
  • Institute of Biological Chemistry, Washington State University, Pullman, Washington 99164
  • Department of General Education, Yamaguchi Prefectural University, Yamaguchi 753–8502, Japan
  • Graduated School of Science, University of Tokyo, Tokyo 113–0033, Japan; and Japan Science and Technology Agency, PRESTO, Saitama 332–0012, Japan
  • State Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China
  • National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing100081, China
  • College of Life Sciences, Nanjing Agricultural University, Nanjing 210095, China

References

  1. 1.0 1.1 1.2 Ueda Y, Satoh-Cruz M, Matsusaka H, Takemoto-Kuno Y, Fukuda M, Okita TW, Ogawa M, Satoh H, Kumamaru T (2010) Gene-gene interactions between mutants that accumulate abnormally high amounts of proglutelin in rice seed. Breed Sci 60: 568–574
  2. 2.0 2.1 Masako Fukuda;Liuying Wen;Mio Satoh-Cruz;Yasushi Kawagoe;Yoshiaki Nagamura;Thomas W. Okita;Haruhiko Washida;Aya Sugino;Sonoko Ishino;Yoshizumi Ishino;Masahiro Ogawa;Mariko Sunada;Takashi Ueda;Toshihiro Kumamaru. (2013) A Guanine Nucleotide Exchange Factor for Rab5 Proteins Is Essential for Intracellular Transport of the Proglutelin from the Golgi Apparatus to the Protein Storage Vacuole in Rice Endosperm. 162(2): 663-674.

Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.

Structured Information

Gene Name

Os03g0262900

Description

Vacuolar sorting protein 9 domain containing protein

Version

NM_001056166.1 GI:115452060 GeneID:4332330

Length

5299 bp

Definition

Oryza sativa Japonica Group Os03g0262900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:8680525..8685823

Sequence Coding Region

8682799..8682951,8683334..8683513,8684480..8685262

Expression

GEO Profiles:Os03g0262900

Genome Context

<gbrowseImage1> name=NC_008396:8680525..8685823 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:8680525..8685823 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacaaagctgttcaatcgggtatttgcttctgtcccggaagatgtgaagagtgatgaagaactttttgagaagatgtctttgttacagcagtttatacggcctgaaaacttggatatcaaaccagaatatcaaagtgaaacatcatggctgcttgcacagaaggagctgcagaagataaacatgtataaggctccaagggataagcttgcttgcatcctgaactgctgtaaagtcatcaacaacctacttctaaatgcgtctattgtatcaaatgaaaatcccccgggagctgatgaattccttccagtcctcatctatgttaccataaagcgatacagacgtcaatcacggttggtgtcagaagctcagtatttctttacaaacatcttatccgctgagtctttcatctggaacattgatggggaatcattatcaatggatgaacgagatttccaaaagaagatggacttggcaagggaacgcatgttgggattatcagctagctcagagaatcaggacaaccaaaacaatcttgatgtacgggagcaaaaatcacaaacactgaaagctagcagggattctgatgtcaatctctctttgaaagataatttccaaggtcctggactggaaatgagaagggacagtgatgcaagtagtaacccagttgagcgtgtgcaatcgatttctgatttggagaagaaaggagcagccgagcttctcaaggatgatgacttgaacaaaaaaattcaagagtacccattcctttttgcccgctctggtgatctgactgttgctgatgtagaaaaccttttaaactcctacaagcagctagtactaaagtatgtagcgctttcgcaagggatgggtatcaaccttgaaaaccctcctgttcagagcatgcaaactgtttctgatcttgtggaatctgaggagcctaaaaatgtgaagaatgcagtaaatttcagcgaaggaagcagcaaaaccagtgatgacataaaaaatgatactctttattcagaagtagacaacacgggtacccaacaaactgcggttgacccaagttatcagaaggcacagcaggatgaagcatcagatcaacctgaacatgcatga</cdnaseq>

Protein Sequence

<aaseq>MTKLFNRVFASVPEDVKSDEELFEKMSLLQQFIRPENLDIKPEY QSETSWLLAQKELQKINMYKAPRDKLACILNCCKVINNLLLNASIVSNENPPGADEFL PVLIYVTIKRYRRQSRLVSEAQYFFTNILSAESFIWNIDGESLSMDERDFQKKMDLAR ERMLGLSASSENQDNQNNLDVREQKSQTLKASRDSDVNLSLKDNFQGPGLEMRRDSDA SSNPVERVQSISDLEKKGAAELLKDDDLNKKIQEYPFLFARSGDLTVADVENLLNSYK QLVLKYVALSQGMGINLENPPVQSMQTVSDLVESEEPKNVKNAVNFSEGSSKTSDDIK NDTLYSEVDNTGTQQTAVDPSYQKAQQDEASDQPEHA</aaseq>

Gene Sequence

<dnaseqindica>2275..2427#2810..2989#3956..4738#cgcggcgacccttgacttcctcccccttctctcctcctcccacaaaacgtgaccgaatccggctgatccgagcccgccgacctccccggcttccccgatccggcgacgatggatggcggcggcggaggcgacgccttcgggtccgcgaccgcgccgctggcctggcacgacttcctggagcgcatgcgccagccctccgccgccgacttcgtcaagtccatcaaggggttagctccgccacaaattttcggtgctaggcatatgctcgatctcagttcgtggtctagggatccgagacggaaagcgtgtgccgcgattggttcgtgttacgcggcgcgtgttggttcgatagtgtgtggtgcggggatgggcgattttgctggtatagtggggatttggggagcatttggcgtgggttcaaggggattacgttcccgtgtccttcaatatgtgttagcaaggcgatatgaccgatcgccgtgccggttttgtggggggagcttaatctagggttgctgtttgtctcttcgcctacctgttaaccgtcgtctgtgtagttccgaggtgaagtttaatgccattcctattttctatgtctagggttactgcatttggatagatgagtcgcagcacaatcgatataattgatcagtgtgccggcaatgcaacaatgcgatgtgtgtgggggttgtttgaggaaaattgcatgatcggtttatgcactttgggtgaaatatctaccttggatacagagcatagaagttaacatgcttatttagaaatacatgagttgggatttatgcacagtggcaatgacacatagtagccaaggttgtatctggagattcaacagctgggaggacaccatagttaattcttgacaaatacgcttttctatatgttaggccagaagctgggaatttggaattaaggctttgtaaactagtgagtttacttaattcttctacatgtaggagcacgcttcagcactgccttctttgcctttctttttttaccttttaaaatactagatccagcatccataactaaccaatacttgacatttatgtatgttttcgtatgggaaatacatcatttatgttgttatgtttcatgttatacagctttatcgtaacgttctcgaacagagctcctgaccctgaacatgatagtgcggctgttcaagaattcctggaaaatatggaaggtgctttcagggctcacaccccctgggctggaagttctgaagaagaactagaaagtgccggtgaggtaatcaatttccttgttccgtggtactgctgatatagtaatattacataactagagagatgaacatcaaaattgaatttcagagctctatgttcttgttgattacctgcttgcaaagtaagtcgttaaatttggtttgtccaaatgtcttatgggtaatttccgtatgaactttctatagataagatatgcctgtgttctttttatttttggatttttaattgatgtcactgtgctatatgagtatatgattcttgattcgtggaccatgctgtctttcctttttgacatgatcggattaatgcattgactaaaatctgttagacaacgggatgaactaaacatcctattttggttctactttaacatgagatgaattatttctgtctttcattttccagttatcctattttctggtgaccatgcctgcttgccaaagattcaggcagtcaatccatcatgttatcataatctctgtgtttaacagagatacataataaatgcatctgacttgtatttactcccatcggaaatttggaatgcacggcttcatcaaattatctcaggcattttgattaagaatgtgttggagtactaggaaggaacttagcatccattattgatagagaagaaaatggtgagaaaacctgcgttagaagggattcgaactcaggctggtgctctgctcctggcagctccctgccagccgagctaggtgcctttcttagacactttgattaagactggcagttacgtggaattattaacttattccactagtcatgttgctgtttttaaagtgcagttcaaactcgatacttttaaacttaaactctcctttttcactctcgctctaccctttacctaccgagttcctcttcatcttattgatatattccataaaatgtcataacgttacttgcatattctccaatatatttgtcgttatatcaacatttggattgtcttgtattgtgattttagggccttgagaaatacgttatgacaaagctgttcaatcgggtatttgcttctgtcccggaagatgtgaagagtgatgaagaactttttgagaagatgtctttgttacagcagtttatacggcctgaaaacttggatatcaaaccagaatatcaaagtgaaacatcatggctggtatggaagttgatttcctctctttatacatttttagatttgtgaagatctgttacagtgcagaacctttcaataacattgaactacttgggtattgaggaacctgttgaacctgtctgtctgaagtatatttataaactaatgcttacatgtgaataacattctgcccacttcttatatacactcgctatttagtttatggcattatcatcacagtaatgctgccactgtcaaccctaatctgcgtactgtggtctaatgtcaattctttttgcttgcaaggaccttaattaagggaatacttccagtggcatgcattaactggctcagtgttcaaatatataaatgttctttactaacatatgttcccttctttgtacagcttgcacagaaggagctgcagaagataaacatgtataaggctccaagggataagcttgcttgcatcctgaactgctgtaaagtcatcaacaacctacttctaaatgcgtctattgtatcaaatgaaaatcccccgggagctgatgaattccttccagtcctcatctatgttaccataaaggtatgattcactacttgttaaagtactggttgatgatacaaatgaaccatcaaatattgacaatattatattaagttgttggtgctgtattggagaaagaaaatttgccccctttgatatggcacagattaggtgtcgacttgatggtgactatttgtgtattacctactcaactttgatattttctagaaaaaatataagcctattattggtgcagtggtacgtgatttgttgggcacattgcctcttaatagagttgtcagtgcgctgtgcaacctcatttactgttgcttcgtattacttttagttccaacttctacctatctattatgatgcaggttccatgtctaatctaatagtgagttttgtactgaaatagtttgccagatttgagagcaaccttgtcatgcactcatgcccatcagtacatgtgcttagagcaaccatgaatctgtgaaccatcagttgggcatccctcctctagctaggcactacatcagttttgattacaaatgatggttaaactttcattacaaacctaatagttggcatttgagtggttgtggacttgcttttgaaaactgcagcaaatgaccataaagggcttaagatcagatcatgtacggttatcactttacttttctcttcattaccggaaagagcttgtcaactactgaatggtaagagttaatgatatatgtgctcttctagtttggcctctcaaggtattacgtgcttctggaattactgcagttagcctaaactacccttgcaccgcaattcagcattagttgtagttttgttctatcatctgaactacaatgttatgatccttttgcctgaaaatcatctgtaaagtgtttttatttgtcatttaaattaaggtagccaaaagaatttaagcagtagctgttcttaatgcaggcaaatcctccacagttacactcaaatctattatatatacagcgatacagacgtcaatcacggttggtgtcagaagctcagtatttctttacaaacatcttatccgctgagtctttcatctggaacattgatggggaatcattatcaatggatgaacgagatttccaaaagaagatggacttggcaagggaacgcatgttgggattatcagctagctcagagaatcaggacaaccaaaacaatcttgatgtacgggagcaaaaatcacaaacactgaaagctagcagggattctgatgtcaatctctctttgaaagataatttccaaggtcctggactggaaatgagaagggacagtgatgcaagtagtaacccagttgagcgtgtgcaatcgatttctgatttggagaagaaaggagcagccgagcttctcaaggatgatgacttgaacaaaaaaattcaagagtacccattcctttttgcccgctctggtgatctgactgttgctgatgtagaaaaccttttaaactcctacaagcagctagtactaaagtatgtagcgctttcgcaagggatgggtatcaaccttgaaaaccctcctgttcagagcatgcaaactgtttctgatcttgtggaatctgaggagcctaaaaatgtgaagaatgcagtaaatttcagcgaaggaagcagcaaaaccagtgatgacataaaaaatgatactctttattcagaagtagacaacacgggtacccaacaaactgcggttgacccaagttatcagaaggcacagcaggatgaagcatcagatcaacctgaacatgcatgagttgttggtcaagtatggttggccgtcgaaatacagggaaaacgttgtcaacggcgggtcattctcttatatatcaaggggtgacaactggttacagagaagtgggtgcattgctgtgctcctgaagccacaaaatgtaaatgctggaaactagaatatagagattcaagtccctggaaactagaatatagagattctcttatatcagcgtcgaggaagatcaagattcattctgctgaagcaaagctccttgtcccgacgttcgttcattgatcctttggttatggactcttcaagtttgattttgcggttaataccattttggtaaaccattttacttttgtagttcaaattaaaatatccatatgtgaaattagatccaagagaaaatggcatgaaacataatttgatcgtcttctagttgttgtctttagctgctagtactagtgcataccgatgttcgtcttctacagattagttatcaccggtgttttgagcacctcaacttcatttgtttggtttaaatggacataatttcagggaactattccttccctgtcg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0262900, RefSeq:Os03g0262900