Os02g0771400

From RiceWiki
Revision as of 08:03, 12 May 2014 by Xialin (talk | contribs) (References)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search

Protein Tyrosine Phosphatase

Annotated Information

Function

OsPFA-DSP2 act as negative regulators of the pathogen response in transgenic plants.Ectopic overexpression of OsPFA-DSP2 in rice increased sensitivity to Magnaporthe grisea (M. grisea Z1 strain), inhibited the accumulation of hydrogen peroxide (H2O2) and suppressed the expression of pathogenesis-related (PR) genes after fungal infection[1].

Expression

OsPFA-DSP2 was mainly expressed in calli, seedlings, roots, and young panicles, and localized in cytoplasm and nucleus[1].

Evolution

AtPFA-DSP4,which is homologous to OsPFA-DSP2,overexpressing in transgenic Arabidopsis plants,also exhibited sensitivity to Pseudomonas syringae pv. tomato DC3000 (Pst DC3000), reduced accumulation of H2O2 and decreased photosynthesic capacity after infection compared with Col-0.OsPFA-DSP2 and AtPFA-DSP4 act as negative regulators of the pathogen response in transgenic plants[1].

Gene Ontology Classification

GO accession Type Name Code With
GO:0009987[[1]] biological_process cellular process IEA TAIR:AT1G05000
GO:0008152[[2]] biological_process metabolic process IEA TAIR:AT1G05000
GO:0016787 [[3]] molecular_function hydrolase activity IEA TAIR:AT1G05000
GO:0005575[[4]] cellular_component cellular_component IEA TAIR:AT1G05000

PFAM hits

Accession Name Match Start Match End E-value
PF03162.6 [[5]] Y_phosphatase2 46 198 9.8e-63

BlastP Searches (UniRef 100)

Accession  %Sim Length Description P-value
UniRef100_Q0DX67 [[6]] 94.12 204 Os02g0771400 protein n=2 Tax=Oryza sativa RepID=Q0DX67_ORYSJ 4.2e-98
UniRef100_Q0DDQ5 [[7]] 89.44 161 Os06g0208700 protein n=2 Tax=Oryza sativa RepID=Q0DDQ5_ORYSJ 2.2e-69
UniRef100_Q6DL00 [[8]] 89.44 161 Dual-specificity phosphatase protein n=1 Tax=Oryza sativa Re 2.2e-69
UniRef100_A3B9I2[[9]] 89.44 161 Putative uncharacterized protein n=1 Tax=Oryza sativa Japoni 3.6e-69
UniRef100_B6U4B4[[10]] 74.77 214 Tyrosine specific protein phosphatase family protein n=1 Tax 7.5e-69
UniRef100_F2D6J8[[11]] 75.23 214 Predicted protein n=1 Tax=Hordeum vulgare subsp. vulgare Rep 7.5e-69
UniRef100_C4JAD1[[12]] 75.23 214 Putative uncharacterized protein n=1 Tax=Zea mays RepID=C4JA 4.1e-68
UniRef100_B6TUQ6[[13]] 74.65 217 Tyrosine specific protein phosphatase family protein n=1 Tax 2.9e-67
UniRef100_C5XTH0[[14]] 85.29 170 Putative uncharacterized protein Sb04g034500 n=1 Tax=Sorghum 6e-67
UniRef100_B4F971[[15]] 72.22 216 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4F9 3.3e-66
UniRef100_UPI00015CAEE8[[16]] 82.72 162 PREDICTED: hypothetical protein isoform 1 n=1 Tax=Vitis vini 3.2e-61
UniRef100_B6TNL4[[17]] 77.14 175 Tyrosine specific protein phosphatase family protein n=1 Tax 2.9e-60
UniRef100_B9T828[[18]] 86.54 156 Tyrosine-protein phosphatase SIW14, putative n=1 Tax=Ricinus 2.9e-60
UniRef100_Q9ZVN4[[19]] 85.99 157 Probable tyrosine-protein phosphatase At1g05000 n=2 Tax=Arab 5.9e-60
UniRef100_Q6K461[[20]] 84.18 158 Os09g0135700 protein n=2 Tax=Oryza sativa RepID=Q6K461_ORYSJ 9.7e-60
UniRef100_B9IAK7[[21]] 85.35 157 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9IAK7_P 1.2e-59
UniRef100_UPI00015CD7AE[[22]] 82.39 159 PREDICTED: hypothetical protein n=1 Tax=Vitis vinifera RepID 1.6e-59
UniRef100_B9HZH6[[23]] 84.81 158 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9HZH6_P 3.3e-59
UniRef100_B4FLL8[[24]] 82.5 160 Putative uncharacterized protein n=1 Tax=Zea mays RepID=B4FL 8.7e-59
UniRef100_B9N8H3[[25]] 84.81 158 Predicted protein n=1 Tax=Populus trichocarpa RepID=B9N8H3_P 8.7e-59

Labs working on this gene

  • Key Laboratory of Gene Engineering of Ministry of Education
  • State Key Laboratory of Biocontrol and Guangdong Key Laboratory of Plant Resources
  • School of Life Sciences,Sun Yat-sen University, Guangzhou, People’s Republic of China

References

<references> [1]

Structured Information

Gene Name

Os02g0771400

Description

Putative tyrosine phosphatase family protein

Version

NM_001054792.2 GI:297599967 GeneID:4330871

Length

3886 bp

Definition

Oryza sativa Japonica Group Os02g0771400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:33425073..33428958

Sequence Coding Region

33425223..33425396,33425500..33425543,33425630..33425687,33428497..33428590,33428703..33428947

Expression

GEO Profiles:Os02g0771400

Genome Context

<gbrowseImage1> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:33425073..33428958 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttgacgtaaggaatcaaccggtgctcatccactgcaagagaggcaagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaa</cdnaseq>

Protein Sequence

<aaseq>MQLEISPRQRSQQQKEEEGEHQQRAGEEAVGAVFSIEPWVDAAA VLVPPLNFAEVNDGIFRSGFPAADNFAFLLSLKLRSIVYLCPEPYPEENTRFLEQNGI KLHQFGIDGSKELLVNIPEEKIREALKVILDVRNQPVLIHCKRGKHRTGCVVGCLRKL QKWCLTSVFDEYQHFAAAKARSTDQRFMELFDTSSLMHLTASQC</aaseq>

Gene Sequence

<dnaseqindica>3563..3736#3416..3459#3272..3329#369..462#12..256#aagaggaggatatgcagctggagatttcgccgagacagaggagccagcagcagaaggaggaggaaggcgagcaccagcagcgcgccggcgaggaggcggtgggcgccgtcttcagcattgagccgtgggtggacgccgcggcggtgctggtgccgccgcttaacttcgccgaggtgaacgacggcatcttccgctccgggttccccgccgccgacaacttcgcgttcctcctctccctcaagctacgctcgatcgtgtgagtcctatacctaggatctctttctcggccacggcgaccgtggcggcgagctcgtcgattacgtgttctgacggcggcggcgacgccttggcgtggttgatcggtgcaggtacctgtgcccggagccgtacccggaggagaacacgcggtttctggagcagaacggcatcaagcttcaccagttcggtattgacggcagcaaggtaaatgaacaagtcaaaaatcatatgcgttgagtcctttgattttctgctttattttccacggatggcaaagtcgatcttcgcatcgaattgttttttggtttttcggtcgatttggtgcgttctgcttgtggagataaataatttgcacacataatttgcaccgagaaatagcaactggtatcgcattacagtggatgcgagggttactttaggtagaacgcgctgtttacctgtttgacatgagcacgcacttgcgttttctgcgcgttgcctcgtgtcgtatggccatgagctcgttcgactactttccgttaaaaaaacatgggaactgacaactgatattgctgcttgcttcggcaaaacacttgggggcaacgcaactagggcaaacaacaactcaactagaacaaacaaaagtccctttcttgctttatctttgcccctttcagttagggcatttgcttgagtctttcaggctgaaaatgtttatcgtttttgggttttgttaacctaaattgacaaggttacgtggtgcatggtgactataaaacaccctgtttgagcaaaatgcatctagtgcgctactatttttatgttcttatttcactaattcgttttcccttctcacaaaatagtgtagaaaatctcattatggtaggagttattttttttacaatgcaaaacaacagtgtcagttaagcgggttcttgcgtcagcccagcacccatagaagattagaagttgtttacaatgctgcaaaagcgtatcttgctactggcctactgccattagcaacagtaaagcttatctttgttatgattattctggtagcgttgtgctacttttctagaagctagttcaaactgattggtagactcatggctaaggaaaatattttctatttcagcatcacgcatttcagggttaggagatttttgtctgcattatgccagtctggttctgagttttactgaatactgcaagctttaagggtaaaaaaaaaaaaagaaaacaccttaagcttaagtgatcagtgatgcagtacagcacaagttctactccctctatcaaaaaaaaaactaatcctaaatttgaatctagaaagacggagggagtagctgagaaatgatgggcttgtggagtctcctctgtgaattgggtgcctaaacaaagatcaagttgacttatgcccattattttttttaagagaacttatgtgaaaaaaaaagaggatcaagttgacttatagtataatcgcacctgtcttttaactgtcgagtgacgtctgaccagcgtaattctttcataaatttgttggccatgactttaattccgttattaaccagccacccaagattaccatttctctgtgtgccatgccatatttattctcattttactagtccttcactgaaagccattagtacggttttgtcaagctgtccatattaaaagttcatttaggcatagacgcatagtagccttggagtatgtcggtatattactccatctcgcaactttagtactcgtgtcatcgcgtggtagcatccaccgcaagtctgcaacaatgagaacatattccactgtcagttctgggttcatgaaggcatgaactgccacggcaaatggtcaaagttggtcagcgtcggcgacttaaggctgaggtcgttgcttgggttaggtattcatccctagttcatgcaaaatgacataactcattaacgtatgattaattaagttttagtttttttaaaaaaataaaattaatatgaatataaaatttaaattaactttcatatagatttcatatagatttttgttaaaaaaaacaccgttcagtaattaaaaaaatgtgcatgtgaaaatcgagtgagttaagttgggaccttcaaacaaaaaaaaactttcatcgttcattggcgattgttgctgtcgatgataaacaacacagatgtgctgaccaactttagcattcccagcaaaaaagaaatatatcgctgagtgaaaagacactgatcaggtggctgaccttactacaagtgtgtgaatggaaattagtgctcactttgacattgtctggagatgatgcttctttttcgccggactcaagctaggtgtctgaaaccactgaattacgagggtcaccggtaataattgtgtcactgctagatggattctaggatggtcactgctagatggattgtacggtggtgtttggatcaaggactaaactttagctcctgtcatatcggatgaatttagagtattaaacatagactacttataaaactaattacataaatgagagctaattcgcgtgacaaaatttttaagcctaattaatccataattagcgcatgtttactgtagcatcacataggctaattatgaattaattaggtttaatagattcgtctcgcgaattagtccggggtcatataataggttttattaatagtctatgtttaatatttataattagtgtccaaacatacgatgtgatatggactaaaaagttttagtcccatctaaacagggtctaagcttgtttctttgttaactagaaccaataatgtagtacatacttgagtggcatgacgatatctttgcatctgaactttcgataaaggtgaaccttatcagttaccgcattagcctgaaactgtgaaacaaattaaaacatccttctattgctataccatatcatcagtaattcagtatgcatccaactgaccattctcttcaatcctgttgactcttaaagttgatgcatagcctgacaataatctgaaccttgctgttacaggagctgcttgtaaacatccctgaagaaaaaatccgagaagcactcaaagttattcttggtatctgcctctacaaagatatatccaatgtctcaaaatttcatcacactatctgtatctaactcttatcgttttgatcaattcagacgtaaggaatcaaccggtgctcatccactgcaagagaggcaaggtagctatatctatttagcattgcacatccctgatatcccattttcttgaaaccttttgctacatgggaattcgacggtttcctgatattccacatgtttcagcaccggactggctgcgtcgttgggtgcctgagaaagttgcagaaatggtgcctaacttcagttttcgacgagtaccagcattttgcagcggcgaaggcgagaagtactgatcagagattcatggagctgtttgacacatccagcttgatgcacctgacggcctcacagtgttaaccgaaccgaatgttttttcatatccggtcccgatctgtaaccatgctgtctacctagcaacatattgtaatgttgctattgaaacaattcatcagagaataatgttagaaccatcattatcctcataaaagtatccatcaaaatacaagg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0771400, RefSeq:Os02g0771400

  1. 1.0 1.1 1.2 1.3 Hanjie He,Jianbin Su,Shengying Shu,Yang Zhang,Ying Ao,Bing Liu,Dongru Feng,Jinfa Wang,Hongbin Wang; Two Homologous Putative Protein Tyrosine Phosphatases, OsPFA-DSP2 and AtPFA-DSP4, Negatively Regulate the Pathogen Response in Transgenic Plants, PLoS ONE, 2012, 7(4): e34995