Os02g0553200

From RiceWiki
Revision as of 12:15, 27 May 2014 by Luyuanyuan (talk | contribs) (Background Information)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Background

Soil salinity, particularly due to NaCl, can be considered as the single most widespread soil toxicity problem that global rice production faces at present. Salinity influences a number of physiological processes. These processes include photosynthesis, nutrient uptake, water absorption, root growth, and cellular metabolism.

Roots play a number of important roles during plant growth and development, and typically are the first and critical part of the plant to encounter soil salinity. When growing in saline soil, roots have to cope with two types of stress. The first of these is an osmotic stress resulting from salt concentration in the soil that results in lowered water potential and a consequent loss of cell turgor in roots. The second is ionic stress induced by changes in the concentrations of Na+, Cl-, or both in the root growing medium and within root tissues. In addition to its known components of osmotic stress and ion toxicity, salt stress is also manifested as an oxidative stress, all of which contribute to its deleterious effects.

The increase in reactive oxygen species (ROS) seems to occur as a response to most, if not all, abiotic stresses including drought and salinity. To minimize and/or to protect against the toxic effects of these damaging ROS, cells have evolved highly regulated enzymatic and non-enzymatic mechanisms to keep a balance between ROS production and destruction in order to maintain cellular redox homeostasis. ROS-scavenging enzymes include superoxide dismutase, ascorbate peroxidase (APx), glutathione reductase, and catalase.

APx (EC 1.11.1.11) belongs to the class I haemcontaining peroxidases found in higher plants and catalyses the conversion of H2O2 to H2O and O2 using ascorbate as the specific electron donor. It plays an important role in scavenging and in protecting cells against the toxic effects of H2O2 in higher plants. The fact that APx has a high affinity for H2O2 and is able to detoxify low concentrations of H2O2, whereas catalase has a high reaction rate but a low affinity for H2O2, renders APx an ideal candidate for tight regulation of H2O2. APx is located in different cellular compartments. Eight types of APx have been described for Oryza sativa: two cytosolic (OsAPx1 and OsAPx2), two putative peroxisomal (OsAPx3 and OsAPx4), and four chloroplastic isoforms (OsAPx5, OsAPx6, OsAPx7, and OsAPx8).

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0553200

Description

Similar to Thylakoid-bound ascorbate peroxidase (EC 1.11.1.11) (Fragment)

Version

NM_001053646.1 GI:115446662 GeneID:4329643

Length

3693 bp

Definition

Oryza sativa Japonica Group Os02g0553200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:21726247..21729939

Sequence Coding Region

21726478..21726630,21726710..21726937,21727437..21727541,21727616..21727693,21727776..21727850
,21728505..21728591,21728684..21728751,21728864..21728951,21729051..21729151
,21729261..21729381,21729476..21729637,21729739..21729909

Expression

GEO Profiles:Os02g0553200

Genome Context

<gbrowseImage1> name=NC_008395:21726247..21729939 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:21726247..21729939 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggagcgcatcgccgcctccctcctcccggctgcctcgccctcgcctgctccgtcccctccccccccgcgcccccgcgtctccgccgcggccgccgcctccttcccatgctgctccaccagcgccggcggcctccgcctccgctcccgcccgtctcgcttcccgcagaaggctgcgacgacgaggagcgggcgcgccggcgcgggggcgcgggcggtggtccggtgcatggcggcggcggcggtggcggcgtccgacgcggcgcagctcaagagcgcccgggaggacatcagggagatcctcaagaccacctactgccaccccatcatggtccgtcttgggtggcacgattctggcacgtacgacaagaacatcgaggagtggccgcagaggggcggagccgacgggagcttgagatttgacgccgaattgagccacggagccaatgctggtctgattaatgctttgaagcttatccaaccaatcaaggacaaatacccgggtataacttatgctgatttgttccagttggcaagtgctacagcaattgaggaagctggtgggccgaaaattccaatgaaatatggacgagttgatgtcacagcagctgagcagtgcccaccagaggggaggcttcctgatgccggtccacgtgtgcccgctgatcatcttagggaggtattctacaggatgggccttgatgacaaggaaattgttgcattatctggagcacacacacttggaagatcaagacctgacaggagtggctggggaaagccagaaacaaaatatactaaggatgggcctggtgaacctggagggcaatcatggacagttgaatggttgaagtttgataacagttacttcaaggacataaaagagcaaagggaccaggatcttctagtgctacccacagatgctgcattatttgaggatccgtccttcaaggtatatgccgaaaaatatgcagaggatcaggaggcattctttaaagactacgctgaagctcatgctaaactgagcgaccttggtgcaaagttcgatccacctgagggattttcactggacgatgaaccagccgtcgaagagaaggatcctgaaccagcaccagcgccagcagcagcaccaccacctccaccagtcgaggagaagaaggaagctgaaccaactccagtaccagtaacggtaggagcagcagtggcatcatcgccagcggatgacaacaacggtgcagcaccgcaaccagagcccttcgtcgctgcgaaatactcctacggaaagaaggagctgtcggactcgatgaagcagaagatcagggcggagtacgagggattcggaggcagcccggacaagcctctgcagtccaactacttcctcaacatcatgctcttgatcggagggctggccttcttgacgtctctgctcgggagctga</cdnaseq>

Protein Sequence

<aaseq>MAERIAASLLPAASPSPAPSPPPPRPRVSAAAAASFPCCSTSAG GLRLRSRPSRFPQKAATTRSGRAGAGARAVVRCMAAAAVAASDAAQLKSAREDIREIL KTTYCHPIMVRLGWHDSGTYDKNIEEWPQRGGADGSLRFDAELSHGANAGLINALKLI QPIKDKYPGITYADLFQLASATAIEEAGGPKIPMKYGRVDVTAAEQCPPEGRLPDAGP RVPADHLREVFYRMGLDDKEIVALSGAHTLGRSRPDRSGWGKPETKYTKDGPGEPGGQ SWTVEWLKFDNSYFKDIKEQRDQDLLVLPTDAALFEDPSFKVYAEKYAEDQEAFFKDY AEAHAKLSDLGAKFDPPEGFSLDDEPAVEEKDPEPAPAPAAAPPPPPVEEKKEAEPTP VPVTVGAAVASSPADDNNGAAPQPEPFVAAKYSYGKKELSDSMKQKIRAEYEGFGGSP DKPLQSNYFLNIMLLIGGLAFLTSLLGS</aaseq>

Gene Sequence

<dnaseqindica>3310..3462#3003..3230#2399..2503#2247..2324#2090..2164#1349..1435#1189..1256#989..1076#789..889#559..679#303..464#31..201#aaaaactcactcgactcgagcgcgcgcgccatggcggagcgcatcgccgcctccctcctcccggctgcctcgccctcgcctgctccgtcccctccccccccgcgcccccgcgtctccgccgcggccgccgcctccttcccatgctgctccaccagcgccggcggcctccgcctccgctcccgcccgtctcgcttcccgcaggttcgcaatagttttagctcggctcgtgtttttttttttttgggggtggggggggggttgaatcgaggtgttctgagttgactgatgcgtggcacctgcagaaggctgcgacgacgaggagcgggcgcgccggcgcgggggcgcgggcggtggtccggtgcatggcggcggcggcggtggcggcgtccgacgcggcgcagctcaagagcgcccgggaggacatcagggagatcctcaagaccacctactgccaccccatcatggtacggaacgcccgcgccatctcagctctcgcatccatatgaacagagaagagtcagagatgatgaaatcctgcgatcctgctaccatgtacaggtccgtcttgggtggcacgattctggcacgtacgacaagaacatcgaggagtggccgcagaggggcggagccgacgggagcttgagatttgacgccgaattgagccacggagccaatgctggtacttaatttctcgtgtctcggcagtgcaatttcgaattcaggaaattcgtggagtaatcgtgctgatttccttcataatcgtatggttttggttggaattttgataggtctgattaatgctttgaagcttatccaaccaatcaaggacaaatacccgggtataacttatgctgatttgttccagttggcaagtgctacagcaattgaggtctcagacttcttctctctgctctagtgactttgctagatattttttggatgatcggtagtctatgtgcttgaatcttttgagaaaaatttcttgcaggaagctggtgggccgaaaattccaatgaaatatggacgagttgatgtcacagcagctgagcagtgcccaccagaggggaggcttcctggtcagtgtttccattaagttcttcattctgtttctgatcaacgtttgcatttatgaattgtgagaggaacttatcaaagagtgaccttctggtgttgataaatgccccccagatgccggtccacgtgtgcccgctgatcatcttagggaggtattctacaggatgggccttgatgacaaggtgtggatgatgcaaaaaagaaattagttgcctatctgctatttgttcttcatgtatgttgtataaccatttcttttggactatttatgcaggaaattgttgcattatctggagcacacacacttggaagatcaagacctgacaggagtggctggggaaagccagaaacaaaatatactgtatgttttcttgtccactttggaaactcaacaggaaaaataagttattttcagcagtaggaagttctaggcatggccagaccttcaatgttctacactctgggtatagaatattacatttttggggcatttgcaaatttgccaccggttttttcaatattgcaaggatgctactcgaatgacagttctagtgatatttttgcaattttctagtggcagttttgcaataacgattcaaagtagtggtaaatttgcaattgcccctacattttttgagacattcaggcagaggtgaaaacaatgcatgtacttttttgtgttatcttgtaagtaagcaccatattatgcttttaaaatccgtgaatactttgtccttatgctgtaaataaataatgttttaattcaggattttacaaaatgggttatccttacgtttcttttgtatgcatataatggtaaaatagaattaggatgctaagaacttcatagctaacaactttgtcattctctaagccctgatacttctctgtggggaaatgaagattaacttttcgatgcaatcttaccttaatcacaccagcacaatagcaaatcagattagtttcagttttcagactgacatttaaaggtggcttctattattgtggtctacagaaggatgggcctggtgaacctggagggcaatcatggacagttgaatggttgaagtttgataacagttacttcaaggtgtgttagcattttgtcatggtttacaaaattatttttttcatttgaatatgtgatgattcagctgatgataatgtttcaggacataaaagagcaaagggaccaggatcttctagtgctacccacagatgctgcattatttgaggatccgtccttcaaggttatttggttgtgctcaatttgtggcttgaatagctcataggtcactgtctgaaatatctgcaacatatgcaggtatatgccgaaaaatatgcagaggatcaggaggcattctttaaagactacgctgaagctcatgctaaactgagcgaccttggtgcaaagttcgatccacctgaggtgaggactaccatctttttttttcattttgatctcctggcaaccaattgtgcctaaacaatcataaacaatacgaaagacacttaagctcttaagttcttttattagaacatgccagattttcttcctcttgtttgcaagttcaaaacatgactccctgattcctcgtccacatcgagtagatatcttttgtaatgtattttttttctagagaattcagtaatgtacttatgtgacagtaagatggagtactggaccttcaggacagaaatatagttcagatagtttttctttttaccgaatgtaatccaaacactgggagtttgaggtagtccatcatatcaatctttcttctgcaatgcaacgaaatggggtttactatggcagcttttcttagctgttcttcatgtaaaaaccagtgcaattgtaggttggatatttacagagtccaactttaccagccttcgatcaggaagtgatggatgtgattttcctgcagggattttcactggacgatgaaccagccgtcgaagagaaggatcctgaaccagcaccagcgccagcagcagcaccaccacctccaccagtcgaggagaagaaggaagctgaaccaactccagtaccagtaacggtaggagcagcagtggcatcatcgccagcggatgacaacaacggtgcagcaccgcaaccagagcccttcgtcgctgcgaaatactcctacggaaaggtatgcactctccacgaagcctagcttctagccctagatttgatggacaatgcatggtatcttgcaatggcttttgcagaaggagctgtcggactcgatgaagcagaagatcagggcggagtacgagggattcggaggcagcccggacaagcctctgcagtccaactacttcctcaacatcatgctcttgatcggagggctggccttcttgacgtctctgctcgggagctgagagcgatggtctgatgacctcctctgacgagtgttttgagttgttctgcctgtgctaagatttgcgtgtttctctttccatgttttgagtcgttattccgtaaataaattgaggtaaaaggatgggcatgtgaatggattccagtactttctgaacttcttgagtaattcctctagagaaatatttgtcggagagaaatgtcacattatctagttgtcatggctcatgact</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0553200, RefSeq:Os02g0553200