Difference between revisions of "Os02g0203700"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
+
As a '''zinc finger protein gene''', '''''SRZ1''''' (stress repressive zinc finger protein 1) was '''cloned''' from rice<ref name="ref1"/>.
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
*SRZ1 encodes a protein with three C2C2-type zinc finger motifs that are structurally similar to human ZNF265 zinc fingermotifs<ref name="ref1"/>.
 +
 
 +
*SRZ1 and its relatives in plants may play '''negative roles''' in '''abiotic stress signaling''' and the '''down-regulation''' of them might be '''crucial for plant tolerance against stresses'''. ''SRZ1'' might function as a '''upstream repressor''' of '''some abiotic stress-related genes''' and the repression of these genes might lead to the sensitivity of transgenic plants under abiotic stress<ref name="ref1"/>.
 +
 
 +
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0008270 GO:0008270]
 +
 
 +
===Mutation===
 +
The transgenic tobacco plants<ref name="ref1"/>:
 +
*line 3
 +
*line 9
 +
*The seeds of transgenic and wild-type plants were germinated and grown on 1/2 MS medium for 14 d and then transferred onto 1/2 MS medium (without sucrose) supplied with 200 mM '''NaCl''' for 5 d.
 +
*For '''cold stress''', the 14 d old transgenic or wild-type seedlings were transferred to soil and grew for 2 weeks. After the seedlings were subjected to cold treatment (4 8C) for 24 h, most of transgenic plants were '''wilted''' while wild-type plants grew normally. *Thus, expression of SRZ1 in tobacco '''increases plant sensitivity to cold''' and '''salt stresses'''.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
*SRZ1 was expressed with '''high level in leaves''' and markedly '''repressed by salt''', '''cold''', '''drought''' and '''abcisic acid stresses''' but not by salicylic acid and blast inoculation in rice seedlings. '''Ectopic''' expression of ''SRZ1'' in '''tobacco plants''' '''repressed''' expression of abiotic stress-related genes including osmotin, NtERB10B, NtERB10C, and '''increased plant sensitivity to cold and salt stresses'''<ref name="ref1"/>.
 +
 
 +
*The tissue expression pattern showed that SRZ1 gene was expressed with '''high level in leaves''' but '''low in roots'''. As to '''metal ion stresses''', SRZ1 expression was specifically '''repressed by FeCl<sub>2</sub>''' treatment but not by ZnCl<sub>2</sub> and CdCl<sub>2</sub> treatments under experimental conditions. SRZ1 '''decreased tolerance to cold and salt stress''' in '''tobacco'''<ref name="ref1"/>.
  
===Evolution===
+
===Subcellular localization===
Please input evolution information here.
+
Histochemical analysis showed SRZ1-GUS fusion protein was located throughout the cell in roots and leaves of stable transgenic tobacco plants, indicating that SRZ1 was '''localized in cytoplasm in tobacco cells'''<ref name="ref1"/>.
  
You can also add sub-section(s) at will.
+
===Knowledge Extension===
 +
Plant SRZ family might play negative roles in response to abiotic stress and the down-regulation of SRZ genes might be crucial for plant tolerance to stresses. Further studies such as characterizing plant SRZ knock-out mutants will be essential to conclude the precise function of plant SRZ family<ref name="ref1"/>.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Huang J, Wang M M, Jiang Y, et al. Stress repressive expression of rice SRZ1 and characterization of plant SRZ gene family[J]. Plant science, 2008, 174(2): 227-235.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 03:20, 12 March 2015

As a zinc finger protein gene, SRZ1 (stress repressive zinc finger protein 1) was cloned from rice[1].

Annotated Information

Function

  • SRZ1 encodes a protein with three C2C2-type zinc finger motifs that are structurally similar to human ZNF265 zinc fingermotifs[1].
  • SRZ1 and its relatives in plants may play negative roles in abiotic stress signaling and the down-regulation of them might be crucial for plant tolerance against stresses. SRZ1 might function as a upstream repressor of some abiotic stress-related genes and the repression of these genes might lead to the sensitivity of transgenic plants under abiotic stress[1].

GO assignment(s): GO:0008270

Mutation

The transgenic tobacco plants[1]:

  • line 3
  • line 9
  • The seeds of transgenic and wild-type plants were germinated and grown on 1/2 MS medium for 14 d and then transferred onto 1/2 MS medium (without sucrose) supplied with 200 mM NaCl for 5 d.
  • For cold stress, the 14 d old transgenic or wild-type seedlings were transferred to soil and grew for 2 weeks. After the seedlings were subjected to cold treatment (4 8C) for 24 h, most of transgenic plants were wilted while wild-type plants grew normally. *Thus, expression of SRZ1 in tobacco increases plant sensitivity to cold and salt stresses.

Expression

  • SRZ1 was expressed with high level in leaves and markedly repressed by salt, cold, drought and abcisic acid stresses but not by salicylic acid and blast inoculation in rice seedlings. Ectopic expression of SRZ1 in tobacco plants repressed expression of abiotic stress-related genes including osmotin, NtERB10B, NtERB10C, and increased plant sensitivity to cold and salt stresses[1].
  • The tissue expression pattern showed that SRZ1 gene was expressed with high level in leaves but low in roots. As to metal ion stresses, SRZ1 expression was specifically repressed by FeCl2 treatment but not by ZnCl2 and CdCl2 treatments under experimental conditions. SRZ1 decreased tolerance to cold and salt stress in tobacco[1].

Subcellular localization

Histochemical analysis showed SRZ1-GUS fusion protein was located throughout the cell in roots and leaves of stable transgenic tobacco plants, indicating that SRZ1 was localized in cytoplasm in tobacco cells[1].

Knowledge Extension

Plant SRZ family might play negative roles in response to abiotic stress and the down-regulation of SRZ genes might be crucial for plant tolerance to stresses. Further studies such as characterizing plant SRZ knock-out mutants will be essential to conclude the precise function of plant SRZ family[1].

Labs working on this gene

  • State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Huang J, Wang M M, Jiang Y, et al. Stress repressive expression of rice SRZ1 and characterization of plant SRZ gene family[J]. Plant science, 2008, 174(2): 227-235.

Structured Information

Gene Name

Os02g0203700

Description

Similar to Testis expressed sequence 13A protein

Version

NM_001052775.1 GI:115444920 GeneID:4328666

Length

7423 bp

Definition

Oryza sativa Japonica Group Os02g0203700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:5798925..5806347

Sequence Coding Region

5799260..5799273,5799377..5799447,5800163..5800578

Expression

GEO Profiles:Os02g0203700

Genome Context

<gbrowseImage1> name=NC_008395:5798925..5806347 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:5798925..5806347 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaacaggaagccaggagactgggactgcagggcgtgccagcacctcaacttcagccgccgggacctatgccagcgctgcggcgagccgcgtggcgccgctgatcgcggcagcggtggtggcggtgactacgccaacttcggcggccgtggtggttcctccttcggtggaggctttggcactggctctgatgtccgcccaggtgactggtactgcaactgcggcgcgcacaacttcgccagccgctccagctgcttcaagtgcgctgctttcaaggacgatgctgccgtcaacagtggcggcgctggtgcctttgatggtggggacatgtcgcgctcgcggggctacggcttcggcagcggcgccgtccgcgccagccgccctggctggaagtctggcgactggatttgcaccaggtctggatgcaatgagcacaacttcgccagcaggatggagtgcttcaggtgcaacgcaccgcgggactccggcactgaggtgtaa</cdnaseq>

Protein Sequence

<aaseq>MNRKPGDWDCRACQHLNFSRRDLCQRCGEPRGAADRGSGGGGDY ANFGGRGGSSFGGGFGTGSDVRPGDWYCNCGAHNFASRSSCFKCAAFKDDAAVNSGGA GAFDGGDMSRSRGYGFGSGAVRASRPGWKSGDWICTRSGCNEHNFASRMECFRCNAPR DSGTEV</aaseq>

Gene Sequence

<dnaseqindica>7075..7088#6901..6971#5770..6185#atttattatctcgtcgtctcgtcttcctccctcctccgcctgatcgagatcgcttctgctccagccgccgccgccgccgccgccgaagtccgcaggtgcgaggacgccgacgagtctccagagagcaggtgcgtgcgcgttctccctccccttcttcttctcccgctcggtttgtttcgttcgtttcgggtgatgcgctttaatttgcatgtttgatcgattcctgttcgtggagacgggttggattgggtgatcggtgcgggaggaggggggcggattcacggaatcgagggtagatttgtgcaatttttgcgggcgatgatggcgtgtctccctcccctggctatctcctccgtgtgtcgaattttttttcttgcgagcattagcaacgtctcgttcgcgcgcggtagggtttgtggggggagaggtccccggcgtcgagattcgtgccgccgttgatcgttcgacagctgttgcatccgattcgatgtgggtgcgcgccgcaggggaggggtggggcagagctggtggtggttttttgctcttggagccttggatgagtgggggcatgatccttgttgtagagtatagggacttacagctatgggtttgtggattttttactggtacatatcttctttagttgcaagagaaaagtgatagctatgttggctgtgggtttgttgtgtgctctgaatttttttttaggcttttgtagtttgtcttatgtgattacctttgactgtcactcattttaaacttttcttgtttgtcatactaagtaaggtataagtcatgcttagatgaaagtatgaaaccatgtctagtcatcgatgttatgtgctattaagaaataaataggatttagcacggtgagcgcgtctggatatgtgtgcggggctgtggctgccaacgcgcaacgctcggttatgatgtgctatcatgctgtgcactgttcatgatacggtccatctgctgactggggctttgatgccctgaaggactaaacctaaagaggatttagatctttttgttcatctccatgatgcattgcagtgcaccacatcgaatgtatacaagaaagctggtcagccaaactgggtggtggctaactttcaccttgtcaaggccagattacgtcatcctgaaactatagtagtgcatgcaagtgtggtgaatcaatacagcacacatgccatggaatctattgtacccatggtgtgcgcaactgcgcatccaacttataacaatatataattaaaggtttgtgtactgtagtgttgctctgttttgggtagatgccttcatcctagcccatacgtgtgccttcccattgctatgtgggtaatggcgcaagacacttagttaaaccagatctatgctcgtgcaattgttctcagtgaggaattagtgcatgaacgactaggaaacagatgtgctctgcagtctgtctttggaatctacaggccaagatactccatgcaagatttcaagtgcaactaatcattcaatttctaggaataagagcatactttaagtcttaaaccaatgtttgcaaaagtgaggacagcgtatgattgtttatgactgtttgactattctgtgagctccaatgaggtccgggtaggtgccgcatggcatgaatttttgttgtttatatcaagttcaactggtgttcatatatatcgttcatatatccatgacacgctttcctcacccacataggggactagtgctttacattgtggaatctgtatccctgtgatcacaagcaatttaattttttagtgaaatcagaagcagtttaatacctcaagtttatataaatggtgatttgatcccacaattgactatctaccaagatttaaaatcatattctgctacatatagtcgaacgctaacatggatttttagtttgcactttgtagtttattaatgtatacctagtaatttcccatgtagaactcaggtacttagaagcttagtcatgttttagccgcaccagtcaaacagatacttttgacagtgggactattgctgaagatttttggtgttctatcagtagtactcatactggttttagtacgcttattaacacaaaagctaaaaggcttgagctgttcttcttggttgtgcaaaagcagagaatcaaagcatgttaggttatcaagtgatcgcttcctttggagtttggtcatggtcatgcatggaagcacttccctaggagagaatccaagctagcttttggcccctcagtttttttcccaaggactccatgatttgtatttgcttctgctttcacttcacccaagagaatggaatggaagagaaggcatatcatcctatggttttgaaacctacatatcccctcctggcatctactatcagtctaccaccagtgctagtgctagcaaatatagtacagtgacataatagaaaaaatagatagatgaaaagcaaaagtaaatccactgatgtaaagcctcaacctcaaggatgagcacaagtaaaggggcaaggaaacaacagaagagatgcaaaacacaaccggaaataaaaggaggtgaaaaagaattctaaagaggatggtcactggcacccttgaagactactgcctcttgatttctctatctttattgaaattcatgcattattatcagttatgcatcaggccatctctatttgctttctgccatcatgttcatcttgggttgtgaaatgaaggttaatttaagatgatgggatctttctctgttttcggaaattccttctcaatgtttcctcttataaaaaaggataaagccaattgctcaccacttacagctcagcaatccattatgtctgtcttgatttcaagtggttccttttctttcacttacccctgtcagcagtattaactccctgtcagtatgctttgggtttgcattagacaaaattgcacaactctattatggatatgactagagggctagaggctactatttttagttaatatgaacaaagttgtgtttccgtagcaccttattgttgataagagagggaacacaaggggcccaaagaggtgcttgaatttctgaaaggttccgaggatgtccttccaaacaaataagctcaggcaatgactgagcaaaagtgcatcaagtaactgatagttatcaaacttttatttgttactcttgtcaacataagaactatattaattaatcccaatctcagaataaatcttattcactgtgagatattctctctgaagaaaaaagagtttcgttcggtagatttaactttagttgagatgatacttctttcatggttttaaactagtgtaagttttgctttgtaacttgcacatcatgtcatttccatgtagatgttcaccttgtaggtatgttgacaaaagttttatgcccctttctatccttgcatctcgaatattcacatggtctacaagatcatggatcaattcatgcttgttccttcctatccaaaattttagccagtctatttgtaatctataaaaaagtcacacttcatttgagctctgcttgatatctattttttttggtctatactgatttatttctgccatcttaattagtgacaaaaaatgctttagccggttaattatgcttacaccagagtcatgggatttttcctagtttagataaactgttctatgttacactaacggatggttgatttgctattttggcggataattcaccggacatagttttaggcttgagccgatgtgaccgtttgttggaatggatgccatggaatttcctcaattattgctagtgaaagaaggcaaagttagcatcgaatataagggatgagaatagctttttatagttgcaagaatggatagttatatagcaatagatatagcataagttcagaatgataaccaccattcttgtcacctcatagacttgctcttttgagacctcacagattaactcatttaggtctatatccattttctcgtagaatcaataataagtgctgcttttacactctgcttctcttcttttcataagtttggtgtaatgcttgaaatagttgtgcaaatgcagtattctggttccatcacacgtgtgtggatagctctggagcaccggtagcacaattgcacaattcagtgtgatacgctgcattattaggcataactaattagattttgcactcttttagaatagatatggtttgccttgccattttggaatctgctaaagaagagggtgatgtgttggcccttggaaaattggaatgtcaggaattctgtctcacaacagttaacacagcaggcctcaactgcatgtctaaccaaatatgtacctattcttgatgtgaaactatacattcgctgtccataaagttcctgatatgtcagtctcgggtgaacacagattaaatatcatgtggtcctgactcgtctcagttatcctcatttgattggaacatttgaactagatacaatcaaatcaaaaccctcaggatcacccttttattctctgagacttaatctgaaactatttgtatctctcttatcaaaagcagaaaaaggtcagtcaatactcaaattagaatctttgccatttttagacatgaaacacttcttgattcagccatgcttgtccaaaattaaatatcgacctaagcacaataattcaggacctaatttcgagtcttttctttttcctcttgaaaccatgatgtgtcagtttcaagaatattggttatcactagctccaacactgtgaatcagtcttttacttgacctgaagatgtacaatccttttcatgtggaaatttgggaaatgtcaaacgcaccagtcttgcaaaactgttttctcatgagaccaataacttttgactcaagctgtacttaaagaacaaaaggagatatctaattgagtgtagatttatttctaaaaatttccagtctgatctaaagtcccctcttattgttggtccataatgctccctgaaaacagaaatagtggataatacttgtactaaccattagctccatttttctgaaatgattttctgttcttcctctgacattccatattagctttggtggctttggttctatatgtattttgctaaaaatattctggtcgaataaccactgttacataactaattgcatcttaatttcctaagcacaagaatattgcgcactagtgccatccctccaccccatgtctcaaaagatgttgccaaggcaggcagagatgcagggtaaaggaagcattcaaactccccatatttcttttgccctttaatggctttctcttcttttctttaactcccctcttctttctagttttacgtgattctcttgttcttcgcgggccaaagtgcaccaaagaaccaaaggcacaaagataacccgcccctcggtttcagcaacccctgccaccgcactataaatacccctgcacattagcacctcgctgcatcaccctttcacctcacagcattttccaccttagagctcaccaacacagcagctgatacttgtttaggtaactgagcttcctgttagtgtttgttcatttgttttgtatgcatgtaagcatgttggttgtggttttcctatttcttgaatgcaaaaggttttgcaaagagagaacagctgggttatcttataagtcaagtgtgcttctgggcttcagtttgatcattttttcttcgcccttgctctgatccaataatctttaatgagtggtacattgttgatgtgcagggtaagacaagatgaacaggaagccaggagactgggactgcagggcgtgccagcacctcaacttcagccgccgggacctatgccagcgctgcggcgagccgcgtggcgccgctgatcgcggcagcggtggtggcggtgactacgccaacttcggcggccgtggtggttcctccttcggtggaggctttggcactggctctgatgtccgcccaggtgactggtactgcaactgcggcgcgcacaacttcgccagccgctccagctgcttcaagtgcgctgctttcaaggacgatgctgccgtcaacagtggcggcgctggtgcctttgatggtggggacatgtcgcgctcgcggggctacggcttcggcagcggcgccgtccgcgccagccgccctggctggaagtctggcgactggatttgcaccaggtgcgtgtcatcactagttaggctatccttttcttttggttttaatatctgtttgctttagcaaatcaactattcatagccaatatatgatttttcccagcccttattatggtataagacagtacatggcatggataatttacatggttaatttagtggtagttacggacttttgaaagcttgtaatatttctccgtaccatttttgcatattagggggggggggtcctgtttcttcagaagagacaggaggatcaactaattatgctgcctgtcttcattcaatcattcatgagaaagctagtggttctgttatgctgcacgagaatattagtagcttatgtatagtaccgtagttgtaactagaggtattcatccatggttttctcaatctgtggaaaaccggaagtagttgagatgacactatatttatcgtagcatgcggcaaattgatcagtatggcctatttttgaacagtttcattcaaaatctgaatgaacggccctaggcctcgagtatcactgatgatgtggtcgctttaaatattatactgataagcgaagtgtctatgtcacatttttagctccctggcaactgtagcagcatagcatgttccatacatctccaatgctggatttgcataacttcgcaatatatgtgtctaataatgaactctgctttctgttaactcttgtattttctatgtttgatcacaggtctggatgcaatgagcacaacttcgccagcaggatggagtgcttcaggtgcaacgcaccgcgggactccggtagcgctatgacatacgaaaattacttgtaaattatcgtgaatctccccttgtctcctgcctcatgtcatgatctgatctcgtgcgtgttatgcatttgcaggcactgaggtgtaatttgccgtacgtgtccgatcgatctggatccgatgaggcttgcagcagtgacgacgagcagcagaagcagcgttaagagttgtgatgtctacataagaagaagaagaaagtagaatgcaaaagaaatctccccatggttttactagttttgtttcttcccgttttagatttggttctgattcccatttgggaggacccgtcgacccctgattatctatgttttacccgttttatttcctgtttctttcggcatgtttgctcttcgatcgagtcgtgtaacccgaaacgcttgcgcttgagaagtattattattattaactagtatgttgcttctt</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0203700, RefSeq:Os02g0203700