Os02g0149800

From RiceWiki
Revision as of 19:08, 22 July 2012 by 124.16.129.48 (talk)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0149800

Description

Protein phosphatase 2C family protein

Version

NM_001052433.1 GI:115444236 GeneID:4328306

Length

3133 bp

Definition

Oryza sativa Japonica Group Os02g0149800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:2744294..2747426

Sequence Coding Region

2744355..2744581,2745334..2745461,2745553..2745651,2745742..2745900,2746125..2746211
,2746300..2746391,2746629..2746703,2746805..2746984

Expression

GEO Profiles:Os02g0149800

Genome Context

<gbrowseImage1> name=NC_008395:2744294..2747426 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:2744294..2747426 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcatgggaggccgtcgaggccattagcttcctcctcgtcgtcgtcgtcgtcccgcgtcttctccttcttcttggcgccgcgggttttcttgttcttggtggtggtggtggtcgtcgtcttcttgccgggtcggtcgtcttgctggtggctggagggcacggaggagttggaggaggagatggggtttgccggggactgctcgccggtcagcggtggcgggctcagtgaaaacggcaagttcagttatgggtatgcaagtgctcctgggaaaagggcttcaatggaggatttctacgagacgagaatcgatggtgttgatggagagaccattggattatttggcgtattcgacggccatggcggagctcgagcggctgaatatgtcaagcagcaccttttcagcaatttaattaagcatccaaagttcatcagtgatatcaagtccgctatcgctgaaacgtacaaccatacagattcagaatttctgaaagccgaaagtagtcacactagggatgctggctcaactgcctcaacagctattcttgtaggcgatcgcttgctggttgctaatgttggagattctagagcagttgtttgtagaggcggggatgcaattgcagtttcaagggatcacaaacccgaccagtcagatgagagacaaagaattgaggacgctgggggcttcgtgatgtgggctgggacgtggcgtgttggtggtgttcttgctgtttctcgagcatttggtgataagctattgaagcagtatgtagttgctgatccagagatcaaggaggagattgtcgatagctcccttgagttcctcatccttgctagcgatggactttgggatgttgtaagtaacaaggaagctgttgacatggtgaggcctattcaggatcccgaacaggcagcgaagaggcttctccaggaggcgtaccaaaggggtagcgccgataacatcaccgttgttattgtccgctttttggagggaacaacgactggtggtggaccaagtagggaggccgccagcgaccaaaactcatag</cdnaseq>

Protein Sequence

<aaseq>MHGRPSRPLASSSSSSSSRVFSFFLAPRVFLFLVVVVVVVFLPG RSSCWWLEGTEELEEEMGFAGDCSPVSGGGLSENGKFSYGYASAPGKRASMEDFYETR IDGVDGETIGLFGVFDGHGGARAAEYVKQHLFSNLIKHPKFISDIKSAIAETYNHTDS EFLKAESSHTRDAGSTASTAILVGDRLLVANVGDSRAVVCRGGDAIAVSRDHKPDQSD ERQRIEDAGGFVMWAGTWRVGGVLAVSRAFGDKLLKQYVVADPEIKEEIVDSSLEFLI LASDGLWDVVSNKEAVDMVRPIQDPEQAAKRLLQEAYQRGSADNITVVIVRFLEGTTT GGGPSREAASDQNS</aaseq>

Gene Sequence

<dnaseqindica>62..288#1041..1168#1260..1358#1449..1607#1832..1918#2007..2098#2336..2410#2512..2691#tacctcgccatcgctctcctcctcctcctccatccattcccctcctcctcctcctcctcccatgcatgggaggccgtcgaggccattagcttcctcctcgtcgtcgtcgtcgtcccgcgtcttctccttcttcttggcgccgcgggttttcttgttcttggtggtggtggtggtcgtcgtcttcttgccgggtcggtcgtcttgctggtggctggagggcacggaggagttggaggaggagatggggtttgccggggactgctcgccggtcagcggtggcgggctcaggtgcgttccttcgctcgatcttgggctttcttgacttgaccctcttttgtgttgccgtggtttcgtgttagggggaagatccaagaggaggaggaggaggaggagaaggatgacaagtttttcatggcgcggtcaggggctttgtgcttgatttgattggcggctaactatcgagtagtgattcttgaatcagaggctaggacatgaggtttcagtggcggattttgaattagatctgcccgattttgctctgaattagcttagcctaatcgggttccagctcctggctggtgtgaggatgtggccatgattttgaatttgaggagtgtttgaaaacgaaaagtctaatcctttgtaagggcatatggtagaggaattaacctttttcttgtttgatgtgtctgtgtgtagcaactgatttttatggagtgttattagttgtagggatctgtagtctgatctgatttggtaggagctccaaaaaaaaaaaaacattcatgaaataacatgtgagaaattgatttatgcaaacaagttctttttttgtccatttagtatgtagtaacagttttgcgccatcggcataaattttcctgcaaatattatcctattaatgtaactgagaacatacagtactgctagctaataaagataacacatttgattgtcacacgaaattaagtgcactggagtccatgattttagattttgcgtatgactaattaataaatgttccccttttctgttgacagtgaaaacggcaagttcagttatgggtatgcaagtgctcctgggaaaagggcttcaatggaggatttctacgagacgagaatcgatggtgttgatggagagaccattggattatttggcgtattcgacggtactgtacagttccacgagaaatattattaattgtttgggttttggtatgtcaggacatccttgatcaacttacttggttgtacatataggccatggcggagctcgagcggctgaatatgtcaagcagcaccttttcagcaatttaattaagcatccaaagttcatcagtgatatcaagtccgctatcggtatggcattaataattcatgcattacggagcaaaaataattgtagccaacctaaaaggtggttgtgatttctctgtacttttcttgcagctgaaacgtacaaccatacagattcagaatttctgaaagccgaaagtagtcacactagggatgctggctcaactgcctcaacagctattcttgtaggcgatcgcttgctggttgctaatgttggagattctagagcagttgtttgtagaggcggggatggtaagtcactaaatctaatgtgtgtaacatacttcagttagtgtccagtgttttcctctatgtccaatttcagcaggatgcttgagaaggcatttgctgtctttcttccaatttccatggttggggtacatggcagttcaaattatctgaataacaggatttcatattagtattatttaacacatgttaatcaatcataatatttctcctgtccacccttgcagcaattgcagtttcaagggatcacaaacccgaccagtcagatgagagacaaagaattgaggacgctgggggcttcgtgatgtgggctggtaatttcatgattcctttgaaattatctattttgctttgtacttgtaatgatcattggttctttctaacggttgaacgactttgcagggacgtggcgtgttggtggtgttcttgctgtttctcgagcatttggtgataagctattgaagcagtatgtagttgctgatccagagatcaaggtttgacttaatttgtttgcttagctctcaactaaagccttctatctgcaaaataatattcatcatcgtaattggcattcccatgcatgttactctaaagtagtccaccaatgaactctactttctacctaagttcttcattgcttttatgcaagaaagcaaacaatgagcctgctccatcaacatatcatttatctttccatttggtaaaagaaatgcatcttgttttatttacaggaggagattgtcgatagctcccttgagttcctcatccttgctagcgatggactttgggatgttgtaagtaacaaggtaacaacagaaatttcttgagtctccttcacccgcttgtatgttgccattggcgccttatatatgttactcaatacatgaaacccaaattctatttccaggaagctgttgacatggtgaggcctattcaggatcccgaacaggcagcgaagaggcttctccaggaggcgtaccaaaggggtagcgccgataacatcaccgttgttattgtccgctttttggagggaacaacgactggtggtggaccaagtagggaggccgccagcgaccaaaactcatagtttctcccaggcagcagcatggcttgttcctgtctgtcatatctgatgctcaaggtagacgattacagtggcggcaccacccaccatgctgccaagaactgacccggcccgaatttcgtcctcgctttcatgctcctggctgaccttaggtggtgatggtggtggtaatgtaggagcagaatggcgatggggccagtgttgttacatatgatatgatcgaaggtgtatcgtgtcttatatataactttgcaatgtagattctatgcttgtgttccatgctaggtctttttttttcttttttagcatcaaatgcatgtaatagaagtaaatttaaacgatttgaacgaagttatacactgcagtatgtaacgaaatctttgcgtttgtatttctgatgccatgagcattatgatttctcataagctccgagggtcaaaactcc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0149800, RefSeq:Os02g0149800