Difference between revisions of "Os01g0746400"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Function)
Line 5: Line 5:
 
Please input function information here.
 
Please input function information here.
  
   D10,carotenoid cleavage dioxygenase 8(OsCCD8)controls lateral bud outgrowth of rice, and then  ultimate control of rice tillers. OsCCD8 is an important enzyme of  biosynthesis Strigolactones process.It´s involved in the biosynthesis of Strigolactones / Strigolactones derivative SL. D10 may plays an important role in regulate Strigolactones and its derivatives by auxin , but may reduce the transport ability of auxin and promote the synthesis of cytokinin by reducing the  auxin levels  at the same time.
+
   D10,carotenoid cleavage dioxygenase 8(OsCCD8)controls lateral bud outgrowth of rice, and then  ultimate control of rice tillers. OsCCD8 is an important enzyme of  biosynthesis Strigolactones process.It´s involved in the biosynthesis of Strigolactones / Strigolactones derivative SL.And  D10 may play an important role in auxin regulation of SL.D10 may plays an important role in regulate Strigolactones and its derivatives by auxin , but may reduce the transport ability of auxin and promote the synthesis of cytokinin by reducing the  auxin levels  at the same time.
  
 
===Expression===
 
===Expression===

Revision as of 11:09, 26 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

   D10,carotenoid cleavage dioxygenase 8(OsCCD8)controls lateral bud outgrowth of rice, and then ultimate control of rice tillers. OsCCD8 is an important enzyme of biosynthesis Strigolactones process.It´s involved in the biosynthesis of Strigolactones / Strigolactones derivative SL.And D10 may play an important role in auxin regulation of SL.D10 may plays an important role in regulate Strigolactones and its derivatives by auxin , but may reduce the transport ability of auxin and promote the synthesis of cytokinin by reducing the auxin levels at the same time.

Expression

D10 is a carotenoid cleavage dioxygenase, mainly expressed in vascular cells of various organs, and induced by exogenous auxin. In addition, the expression of D10 up-regulated in 6 mutated branches,including d3,d10,d14,d17,d27,htdi.But MAX2 and MAX3 rice homologous gene D3 and HTD1 have no expression change in these mutants. These finding may indicate that D10's transcription may be key factor of regulating branches inhibition pathway.(Arie et al.,2007)

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

  

(D10) is a rice ortholog of MAX4/RMS1/DAD1,

Labs working on this gene

Please input related labs here.

   1 The State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese 
     Academy of Sciences
   2 College of Biological Sciences and Biotechnology, Beijing Forestry University
   3 Department of Applied Biological Chemistry, The University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo
   4 RIKEN Plant Science Center, Japan
   5 Research Institute for Bioresources, Okayama University, Kurashiki, Okayama 710-0046, Japan

References

Please input cited references here.

1. Shuying Zhang;Gang Li;Jun Fang;Weiqi Chen;Haipai Jiang;Junhuang Zou;Xue Liu;Xianfeng Zhao;Xiaobing Li;Chengcai Chu;Qi Xie;Xiangning Jiang;Lihuang Zhu

 The Interactions among DWARF10, Auxin and Cytokinin Underlie Lateral Bud Outgrowth in Rice.Journal of Integrative Plant Biology, 2010, 52(7): 626-638

2. Shinsaku Ito;Nobutaka Kitahata;Mikihisa Umehara;Atsushi Hanada;Atsutaka Kato;Kotomi Ueno;Kiyoshi Mashiguchi;Junko Kyozuka;Koichi Yoneyama;Shinjiro Yamaguchi;Tadao Asami .A New Lead Chemical for Strigolactone Biosynthesis Inhibitors. Plant and Cell Physiology, 2010, 51(7): 1143-1150

3. Tomotsugu Arite;Hirotaka Iwata;Kenji Ohshima;Masahiko Maekawa;Masatoshi Nakajima;Mikiko Kojima;Hitoshi Sakakibara and Junko Kyozuka

 DWARF10, an RMS1/MAX4/DAD1 ortholog, controls lateral bud outgrowth in rice.The Plant Journal, 2007, 51(6): 1019-1029

Structured Information

Gene Name

Os01g0746400

Description

Carotenoid oxygenase family protein

Version

NM_001050764.2 GI:297597605 GeneID:4326177

Length

3109 bp

Definition

Oryza sativa Japonica Group Os01g0746400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:32981304..32984412

Sequence Coding Region

32981304..32981461,32981562..32981854,32981954..32982147,32982254..32982997,32984092..32984412

Expression

GEO Profiles:Os01g0746400

Genome Context

<gbrowseImage1> name=NC_008394:32981304..32984412 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:32981304..32984412 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtctcccgctatgctgcaggcgtcgtcgctgtgcgtatccgcggcgctgtcaggcgccgcgagccggccgggccgcctggccagccaggggcaccagggcaagcgggccgtggcgcagcctctcgcggctagcgccgtgacggaggcagcgccgcccgcgccggtcgtcgcgccgccggcccgccccgtcgacgccccgcggcgccgtggcggacgtggcggcggcggaggcggcggcgagctcgtggcgtggaagagtgtacggcaggagaggtgggagggtgcgctcgaggtggacggagagctgcctctctggctggatggcacgtacctgaggaacggcccgggactatggaacctcggcgactacggcttccggcacctgttcgacggctacgcgacgctggtgcgcgtctcgttccgcggcggccgcgccgtgggcgcgcaccggcagatcgagtcggaggcgtacaaggcggcgcgcgcgcacggcaaggtgtgctaccgcgagttctcggaggtgcccaagccggacaacttcctgtcctacgtcggccagctggcgaccctcttctcgggctcgtcgctcaccgacaactccaacaccggcgtcgtcatgctcggcgacggccgcgtgctctgcctcacggagaccatcaagggctccatccaggtcgacccggacacgctcgacacggtcggcaagttccagtacacggacaagctgggcgggctgatccactcggcgcacccgatcgtgaccgacaccgagttctggacgctgatccccgacctgatccggcccggctacgtggtggcgaggatggacgccggtagcaacgagaggcagttcgtcggcagggtggactgccgcggcgggccggcgccagggtgggtgcactcgttccccgtcaccgagcactacgtcgtcgtgccggagatgccgctccgctactgcgccaagaacctcctccgcgccgagcccacgccgctgtacaagttcgagtggcacctcgagtccggcagctacatgcacgtcatgtgcaaggccagcggcaagattgtggcgagcgtggaggtgccgccgttcgtgacgttccacttcatcaacgcgtacgaggagacggacgaggaggggcgcgtgacggcgatcatcgccgactgctgcgagcacaacgccaacaccgccatcctcgacaagctccgcctccacaacctccgctcctccagcggccaggacgtcctccccgacgccagggtggggcggttcaggatccccctggacgggagccagttcggcgagctggagacggcgctggacccggaggagcacgggcggggcatggacatgtgcagcatcaacccggcgcacgtcggcagggagtaccggtacgcctacgcctgcggcgcccgccggccgtgcaacttccccaacacgctcaccaaggtcgacctggtggagaggacggccaagaactggcacgaggagggctccgtgccgtccgagcccttcttcgtgccacgccccggcgccaccgaggaagacgacggcgtggcgatatcgatggtgagcgccaaggacgggtcgggctatgcgctggtgctggacggcaagacgttcgaggaggtcgcgcgggccaagttcccgtacgggctgccctacggcttgcactgctgctgggtgcccaggaaaaggaacagcaagtaa</cdnaseq>

Protein Sequence

<aaseq>MSPAMLQASSLCVSAALSGAASRPGRLASQGHQGKRAVAQPLAA SAVTEAAPPAPVVAPPARPVDAPRRRGGRGGGGGGGELVAWKSVRQERWEGALEVDGE LPLWLDGTYLRNGPGLWNLGDYGFRHLFDGYATLVRVSFRGGRAVGAHRQIESEAYKA ARAHGKVCYREFSEVPKPDNFLSYVGQLATLFSGSSLTDNSNTGVVMLGDGRVLCLTE TIKGSIQVDPDTLDTVGKFQYTDKLGGLIHSAHPIVTDTEFWTLIPDLIRPGYVVARM DAGSNERQFVGRVDCRGGPAPGWVHSFPVTEHYVVVPEMPLRYCAKNLLRAEPTPLYK FEWHLESGSYMHVMCKASGKIVASVEVPPFVTFHFINAYEETDEEGRVTAIIADCCEH NANTAILDKLRLHNLRSSSGQDVLPDARVGRFRIPLDGSQFGELETALDPEEHGRGMD MCSINPAHVGREYRYAYACGARRPCNFPNTLTKVDLVERTAKNWHEEGSVPSEPFFVP RPGATEEDDGVAISMVSAKDGSGYALVLDGKTFEEVARAKFPYGLPYGLHCCWVPRKR NSK</aaseq>

Gene Sequence

<dnaseqindica>2952..3109#2559..2851#2266..2459#1416..2159#1..321#atgtctcccgctatgctgcaggcgtcgtcgctgtgcgtatccgcggcgctgtcaggcgccgcgagccggccgggccgcctggccagccaggggcaccagggcaagcgggccgtggcgcagcctctcgcggctagcgccgtgacggaggcagcgccgcccgcgccggtcgtcgcgccgccggcccgccccgtcgacgccccgcggcgccgtggcggacgtggcggcggcggaggcggcggcgagctcgtggcgtggaagagtgtacggcaggagaggtgggagggtgcgctcgaggtggacggagagctgcctctctggctggtgggttaagcctcctactgattgcaaatctccctaaatatgacttgatttggcttttgccttctctccaccctaattaagtattcatgaacacaccataacctcagcattttataagatctgccggtggtcaagctaaggctagccgtgcatttttcattcaagaatgcgaatcttttctgttattttgattcaaaggtttcccagtactccatatcgctttcttgagatcatctataaactaaagatccttttgaacatcttagtaaaaaagcatgcacaacatcttcccacacattgagaaatacgaaaggcactttctggaccacatcactgtgcaacaaatcctttataattaacctaaccattttcatcttgtagcatctccttgattagtgcaggctaaccgctgacctagagcacatatatgcatatagccccagaagggtcctaaaaaggtaccagctttggccacgtacctagcatatttttaccagcagtatctaacacgccagggtatattacttgccgactgtcatttttaatttccactgtgccagcagttgctgaagcactcacccaaatcttcagtaatttgatcgacaaagaggagggcgacactaacttaccctatgctggcctagcgaaaaggagatggcatcttggcactcacgatgcttgcggggaacacaacatatatacccagattctctgctcacccctagcttcgatcggcgacaacaatggcatcactgtcttgtggttgcagttttgttgcaccccgcaactctctgaaaacaaaagtcaaaaaccttggtctcccctaactccaagtgatcttatcactgttcttgccaattttgatagtgacttgatttgaggaattaatacaggtgtacatgtagtataatattgttgtaactttgtagttacactcactaagctatggataatacaatcgtttcagctaattaaaaatgcaatcttctgaggtaagctcgtggatagattaatttgtcggtcgttaattagaggtggacggatttgtcgacgtgctgcaaatgattgatcggatcgatgcatacttgctgcaggatggcacgtacctgaggaacggcccgggactatggaacctcggcgactacggcttccggcacctgttcgacggctacgcgacgctggtgcgcgtctcgttccgcggcggccgcgccgtgggcgcgcaccggcagatcgagtcggaggcgtacaaggcggcgcgcgcgcacggcaaggtgtgctaccgcgagttctcggaggtgcccaagccggacaacttcctgtcctacgtcggccagctggcgaccctcttctcgggctcgtcgctcaccgacaactccaacaccggcgtcgtcatgctcggcgacggccgcgtgctctgcctcacggagaccatcaagggctccatccaggtcgacccggacacgctcgacacggtcggcaagttccagtacacggacaagctgggcgggctgatccactcggcgcacccgatcgtgaccgacaccgagttctggacgctgatccccgacctgatccggcccggctacgtggtggcgaggatggacgccggtagcaacgagaggcagttcgtcggcagggtggactgccgcggcgggccggcgccagggtgggtgcactcgttccccgtcaccgagcactacgtcgtcgtgccggagatgccgctccgctactgcgccaagaacctcctccgcgccgagcccacgccgctgtacaagttcgagtggcacctcgagtccggcagctacatgcacgtcatgtgcaaggccagcggcaagattgtaagccatcatcaatcgctgccgcccgtagtgcgttcccgttttgcctatttaattggttgggtgatctaatgatgatatttgtcgggacgatggccaaccgaaggtggcgagcgtggaggtgccgccgttcgtgacgttccacttcatcaacgcgtacgaggagacggacgaggaggggcgcgtgacggcgatcatcgccgactgctgcgagcacaacgccaacaccgccatcctcgacaagctccgcctccacaacctccgctcctccagcggccaggacgtcctccccgacgccaggtacgtacacacacgagccacacgacgacgtcccgccgtcaatttgctacgctacgcatgcacgtatgcacgatggatgacggggaacaccatgtgtagggtggggcggttcaggatccccctggacgggagccagttcggcgagctggagacggcgctggacccggaggagcacgggcggggcatggacatgtgcagcatcaacccggcgcacgtcggcagggagtaccggtacgcctacgcctgcggcgcccgccggccgtgcaacttccccaacacgctcaccaaggtcgacctggtggagaggacggccaagaactggcacgaggagggctccgtgccgtccgagcccttcttcgtgccacgccccggcgccaccgaggaagacgacggttagtgtcaccatctctcctcgttggctgcgtatacgtacgtcttggctttgcctcgtttcgtttgtaataacttgaccaactctgttattgatggcaggcgtggcgatatcgatggtgagcgccaaggacgggtcgggctatgcgctggtgctggacggcaagacgttcgaggaggtcgcgcgggccaagttcccgtacgggctgccctacggcttgcactgctgctgggtgcccaggaaaaggaacagcaagtaa</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0746400, RefSeq:Os01g0746400