Difference between revisions of "Os01g0733200"
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice. Furthermore, OsHsfC1b is | |
| + | involved in the response to osmotic stress and is required for plant growth under non-stress | ||
| + | conditions. | ||
===Expression=== | ===Expression=== | ||
| − | + | Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2. | |
===Evolution=== | ===Evolution=== | ||
| − | + | Impaired | |
| + | function of OsHsfC1b in the hsfc1b mutant and the amiRNA lines led to decreased salt and | ||
| + | osmotic stress tolerance, increased sensitivity to ABA, and temporal misregulation of saltresponsive | ||
| + | genes involved in signalling and ion homeostasis. | ||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany | |
| + | Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany | ||
| + | CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France | ||
| + | State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China | ||
==References== | ==References== | ||
| − | + | 1.Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica | |
==Structured Information== | ==Structured Information== | ||
Revision as of 10:26, 28 May 2014
The rice OsHsfC1b gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.——FuhinWong（2014）
Contents
Annotated Information
Function
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice. Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions.
Expression
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2.
Evolution
Impaired function of OsHsfC1b in the hsfc1b mutant and the amiRNA lines led to decreased salt and osmotic stress tolerance, increased sensitivity to ABA, and temporal misregulation of saltresponsive genes involved in signalling and ion homeostasis.
You can also add sub-section(s) at will.
Labs working on this gene
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
References
1.Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica
Structured Information
| Gene Name |
Os01g0733200 |
|---|---|
| Description |
Similar to Heat shock transcription factor 29 (Fragment) |
| Version |
NM_001050695.1 GI:115439760 GeneID:4324158 |
| Length |
1210 bp |
| Definition |
Oryza sativa Japonica Group Os01g0733200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:32338331..32339540 |
| Sequence Coding Region |
32338482..32338730,32338840..32339343 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:32338331..32339540 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:32338331..32339540 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq> |
| Protein Sequence |
<aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq> |
| Gene Sequence |
<dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica> |
| External Link(s) |
