Os01g0110100

From RiceWiki
Revision as of 04:16, 25 June 2012 by 127.0.0.1 (talk) (Created page with "{{JaponicaGene| GeneName = Os01g0110100| Description = Conserved hypothetical protein| Version = NM_001185200.1 GI:297719534 GeneID:9270401| Length = 5643 bp| Definition ...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gene Name

Os01g0110100

Description

Conserved hypothetical protein

Version

NM_001185200.1 GI:297719534 GeneID:9270401

Length

5643 bp

Definition

Oryza sativa Japonica Group Os01g0110100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:536712..542354

Sequence Coding Region

540732..540959

Expression

GEO Profiles:Os01g0110100

Genome Context

<gbrowseImage1> name=NC_008394:536712..542354 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:536712..542354 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggtgcctatgctaagaagcctcgagtacgtcgcttgctactacatcagtggaagctacagaacacaggagtacggatactgcatcaacaccaagcatatcagagatttggcctatgcagtttccttcctgccctactactggagagccatgcaggtcaagccccttatgtccttcacaattctcaattttcaaccatgctctttcaataaaaaaagaaaatga</cdnaseq>

Protein Sequence

<aaseq>MQVPMLRSLEYVACYYISGSYRTQEYGYCINTKHIRDLAYAVSF LPYYWRAMQVKPLMSFTILNFQPCSFNKKRK</aaseq>

Gene Sequence

<dnaseqindica>4021..4248#agcacacaacaatataattaattagcagctgcatgcgtattgctcgttaattaagttgatcatatagaattaaccatggtgaagttctcgaagcaatttgaagggcagcttgtccctgagtggaagcatgcctttgtggactatagcttgctcaagaaagatcttaagaggatgcagcatgattattctccccaagggaccataattaccacctcaacacctcatgatcatcatcagcagcagcaatcagttgcggcgccatcaagttataatttgtctcactgcaggctcctgttgcacaagctcccggcggccttctttggctccaataatgctgatcatgctggagccatacaagtaattgacagtaaatccttgtgctaccatttttatcagttttgcaattaagccatagccatgcatgtgtactgaatcttttgcatgtactgtgtgtgcacatatatatataaatggaaaataggtgcgccggagagtgggcaggggggaggtttacgagacggaggtgacgccggagatggagacgacggcggcgacggcggcgagggagttcttcgcgaggctggacgcgcagctgaacaaggtgaaccacttctacaaggccaaggaggaggagttcctccacagaggtcactccctccggaagcagatggacatactcctcgacctcaagtcgcggtcgtcgtcgtctctctccggccaccaccgcgccgccgccggcgacgacccctccatttcttcttcttccgccacctccggcgccggtgagctacctctctctttctctctctcctgtagtgaccatggttagtgggaagctggtggtgagagaggatggagatgagctagcaggtattgtcatgcacgtaggatcgcattcgcagcaactagcttagcttagcttaattacccaaccccatttcatttcatttcatttcatggtacgtatggtattggtacgtgcgtgagcagcttgcccgggaataatggaatatcctcccctgatcaattgtgtggatgtctttaatgacttgcgtttttgtctgcatttggcacgaccatcatatcaacctcaacatcctactttacttagtgtcgcatcctgtccctcctgataatacctggtatagtagtatttatatattcttctttttctaaagagtacttttgcataggtatatatgccgcgtacagttaacaccttgacaattacaagcatatataattgtgtaggtcgagtttaaaaaactatatatactttgaccaaactatcataaaactatatttaaataccaaattaatatatcacaaaaccatgcatggatttaatatgaagtatcataaaactacatatcgacttagtaatgaagttatcataaaactacatattttagagtttatatttctagcaatattattctgatggagttataaacatagtctaattttggtgataagcttaatgctaaacccttgtggcctttccatggtgtggtttagatatgtacttcctctttgttacatatcataatgttacatatcataagtcattttgattttttaagtcaaatttttttaagtttgatcccatagaaaaatataacaatattttcaactcaaaacaaagaaactatctaaatatgttcaatgttatatgtaatgaaactaatatgatgctataagtgttgctctatttttttttaaacttggtcaaatttaaaaagccaaaacaaattataatatgaaacagaatgagtactaactagtatgcgattagacattttctagtattcaaatttattgtattatgaaatatctaatatcatactaggtagtaacattttgaaaatgtgaagtagtttttctatactaaggtcaaagtatttgtatttttgcaaaagttactttatatatggagattcttttttatgtcaatgctatcccctcattaattcgagaagaataacatgcagatgacatccatacatgaatatatgccaaattatgacagctatctaaaataatggcatttattccctcatgcaaaaaaatctacagttctatatagttcactcaatattaattactgattttttttataaaaaaaactcaaaacagaggatgagtccacgaggtacgtgacgtcagcaacagacacggacgagagccaacacgaaaccgcggtgatgagagaccctgaagagctttcggctgagcagggtctagaagattctggaagcttgtcaaggcagagcctagggaggacagtgagcagctgccagaggaagaacctgaagatcaacatccccctgacgacgccatgcaggacaatctctgcactcaccgacctcctccgggacgatctcgtcagccagcccaagaacaaatgcgactctgacgccggcatcacgttcacgaccatcaacaagacgaagctccggcacgccgagaagatgatcaagggcgccttcatcgagctctacaaaggtcttggatacctcacaacctaccggtaatttaatcaactgctaatctgtcatcctctaggaaatccatgtgtgttcagttcagattcagaagttcagaactgtttgtgtgatgtgaaatgcatgcaggaacctgaacatgatggcgttcgtgaagatcctgaagaagttcgagaaggttagcgggaagcaggtgctgtccgtatacctcagggcggtggagagctcctacttcaacagctccggcgaggctctgaagctgatggacgaggtggaggacgtgttcgtcaggcacttcgccgccggcaacaggcgcaaggccatgaagtacctcaagcccacgcaacggaaggagtcacacactgtcacattcttcatcggtaaacccaaaacaagaatctgcatgcagtttccactttgcaatgacaatctttgtaccactctgaatgtatgtatatgcagggctcatgacgggatgcttcgtggcgctgttcttgggctactgcatcatggcgcacatcgccggaatgtacacgcagcggcgcgactccatctacatggagaccgtctaccctgttttcaggtacacgcatgtagactctgcattttctgaaattctgcgttgatcgaatactgtatctgaattctgacatgaatggcaatggataattttgcagcatgttcagcctaatgttcctgcacctgttcatgtacgggtgcaacatggtggcgtggaggaaggcccggatcaactacagcttcatcttcgagttcgcggccggaagagagctcaagtaccgggacgtcttcctcgtctgcaccgcatccatggccgtcatcgtcggcgtcatgttcgcgcacctctccctcgccgtcaggggattccacgcccaggccatccccggattcttgctcctggtgaactcttctttcttgctccctcctgtcagactgtcgtcagtgtcacactgtcactgtcaacaaggaaccaaattaagaacatgcttttcttgctcattggatggacacgttgatcttgagttgttctcctgcaactggatcgtttcagaatgagaataatcatagtagtaatggaatctgttggtgctgcatgtctgaatgtaggggttcctgctgctgctgttctgcccattcaacatggtgtatcgctccactcggtttcagttcctcaggatactgaggaacatcgttttctcaccactctacaaggtaccacagtacatcttttctttttttttcttttgctaatctcttcatggagaataatgttgccaaattagtccaaattactacatatgttcttatatatcatgatggtttctgaatgtctgcaggttgtaatggtagacttcttcatggcagatcagctctgcagccaggtactactgaatatgctctacttaaaccactcaatccatgtcctgcattcaactgaaacctgaaaaaacaatggggataaacagataattaactttctgaaagaacaaaataaaaaatgcaggtgcctatgctaagaagcctcgagtacgtcgcttgctactacatcagtggaagctacagaacacaggagtacggatactgcatcaacaccaagcatatcagagatttggcctatgcagtttccttcctgccctactactggagagccatgcaggtcaagccccttatgtccttcacaattctcaattttcaaccatgctctttcaataaaaaaagaaaatgaaccatgcaaattttatgttccatatatcagcagtttggaatacacatttattgataaaatggaataaacacacacacaaaacaaaatgcactctgttcagctgaaaagaaaaactctctgaacttcctgaatatttctgaactttctgaaaatgtttgtgtatgttaatcagtgtgcaagacggtggttcgatgagagcgacacgggccacctggtaaacctgggcaagtacgtctcggcgatgctcgccgccggcgccaaagtggcctacgagaaggacaggagccttggatcactctcactcctcgtcatcgtctccagctctgcaacaatgtatcagctctactgggactttgtcaaggactggggcttgctccagcccaactccaagaatccatggctgaggaatgacctcatccttaagagcaagtccatatactacttgtcaatggtatgcatgttcgtcagtctatccccattcagacaggtgtataagcacagccaaaacgagttcatttgcagtagttcagtacaagctgcacgctcaaacacacactgtccaatcgacaaacccgactctcaatctctcaatcacagatcatcgataatgctcaaccgatatccaacctactatttaaaccacactatagtattgaaatggaaacgcaatttgatctgaatttgcaatgaatctgttccggggagaagtgaaccaaacactcaagtgttgtctgaacttttgcagggtctgaaccttgtgctaaggcttgcatggctacaaaccgtgatccatccaaactttgggagtttggactccagggtcacttcattctttctagctgctctcgaggtgatccggagagggcattggaatttctataggtaactgaagtttcagagttctgaacaaccacttatcctaaaaaataaaacagaaaaagcagtagcaggatttaggcaagaaaaatgagatcctgagacctgtggcatatgcttctttttttttttatatcaggctggagaacgagcatctgaacaatgcaggcaaattcagggcggtaaaaacagttccgctgccttttcacgaagctgacgaggaggactgatacgtgctacacaactgctgaatgatcatctgaccaagtgaccatgactagatctaatacttgtttcctcaccactcaattttttttttcaaaagagaaagtctcaagaatggtggagagttcagttcagtgactaaaatactttcactgaaataccttcagggttcagccttcagggaatggcaattgtatgcaactgaagacagtgatccgttcctagatgcattaacatgtataaaatacgcatcgcagtatcgcaaatgacatgaggttacttttgtttggcacc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0110100, RefSeq:Os01g0110100