Os01g0110100

From RiceWiki
Revision as of 11:24, 1 June 2014 by Dychad (talk | contribs) (Labs working on this gene)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

1.National Institute of Agrobiological Sciences, Ibaraki 305-8602, Japan

2.Division of Genome and Biodiversity Research, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan

3.Center for Information Biology and DNA Data Bank of Japan, National Institute of Genetics, Research Organization of Information and Systems, 1111 Yata, Mishima, Shizuoka 411-8540, Japan.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0110100

Description

Conserved hypothetical protein

Version

NM_001185200.1 GI:297719534 GeneID:9270401

Length

5643 bp

Definition

Oryza sativa Japonica Group Os01g0110100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:536712..542354

Sequence Coding Region

540732..540959

Expression

GEO Profiles:Os01g0110100

Genome Context

<gbrowseImage1> name=NC_008394:536712..542354 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:536712..542354 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggtgcctatgctaagaagcctcgagtacgtcgcttgctactacatcagtggaagctacagaacacaggagtacggatactgcatcaacaccaagcatatcagagatttggcctatgcagtttccttcctgccctactactggagagccatgcaggtcaagccccttatgtccttcacaattctcaattttcaaccatgctctttcaataaaaaaagaaaatga</cdnaseq>

Protein Sequence

<aaseq>MQVPMLRSLEYVACYYISGSYRTQEYGYCINTKHIRDLAYAVSF LPYYWRAMQVKPLMSFTILNFQPCSFNKKRK</aaseq>

Gene Sequence

<dnaseqindica>4021..4248#agcacacaacaatataattaattagcagctgcatgcgtattgctcgttaattaagttgatcatatagaattaaccatggtgaagttctcgaagcaatttgaagggcagcttgtccctgagtggaagcatgcctttgtggactatagcttgctcaagaaagatcttaagaggatgcagcatgattattctccccaagggaccataattaccacctcaacacctcatgatcatcatcagcagcagcaatcagttgcggcgccatcaagttataatttgtctcactgcaggctcctgttgcacaagctcccggcggccttctttggctccaataatgctgatcatgctggagccatacaagtaattgacagtaaatccttgtgctaccatttttatcagttttgcaattaagccatagccatgcatgtgtactgaatcttttgcatgtactgtgtgtgcacatatatatataaatggaaaataggtgcgccggagagtgggcaggggggaggtttacgagacggaggtgacgccggagatggagacgacggcggcgacggcggcgagggagttcttcgcgaggctggacgcgcagctgaacaaggtgaaccacttctacaaggccaaggaggaggagttcctccacagaggtcactccctccggaagcagatggacatactcctcgacctcaagtcgcggtcgtcgtcgtctctctccggccaccaccgcgccgccgccggcgacgacccctccatttcttcttcttccgccacctccggcgccggtgagctacctctctctttctctctctcctgtagtgaccatggttagtgggaagctggtggtgagagaggatggagatgagctagcaggtattgtcatgcacgtaggatcgcattcgcagcaactagcttagcttagcttaattacccaaccccatttcatttcatttcatttcatggtacgtatggtattggtacgtgcgtgagcagcttgcccgggaataatggaatatcctcccctgatcaattgtgtggatgtctttaatgacttgcgtttttgtctgcatttggcacgaccatcatatcaacctcaacatcctactttacttagtgtcgcatcctgtccctcctgataatacctggtatagtagtatttatatattcttctttttctaaagagtacttttgcataggtatatatgccgcgtacagttaacaccttgacaattacaagcatatataattgtgtaggtcgagtttaaaaaactatatatactttgaccaaactatcataaaactatatttaaataccaaattaatatatcacaaaaccatgcatggatttaatatgaagtatcataaaactacatatcgacttagtaatgaagttatcataaaactacatattttagagtttatatttctagcaatattattctgatggagttataaacatagtctaattttggtgataagcttaatgctaaacccttgtggcctttccatggtgtggtttagatatgtacttcctctttgttacatatcataatgttacatatcataagtcattttgattttttaagtcaaatttttttaagtttgatcccatagaaaaatataacaatattttcaactcaaaacaaagaaactatctaaatatgttcaatgttatatgtaatgaaactaatatgatgctataagtgttgctctatttttttttaaacttggtcaaatttaaaaagccaaaacaaattataatatgaaacagaatgagtactaactagtatgcgattagacattttctagtattcaaatttattgtattatgaaatatctaatatcatactaggtagtaacattttgaaaatgtgaagtagtttttctatactaaggtcaaagtatttgtatttttgcaaaagttactttatatatggagattcttttttatgtcaatgctatcccctcattaattcgagaagaataacatgcagatgacatccatacatgaatatatgccaaattatgacagctatctaaaataatggcatttattccctcatgcaaaaaaatctacagttctatatagttcactcaatattaattactgattttttttataaaaaaaactcaaaacagaggatgagtccacgaggtacgtgacgtcagcaacagacacggacgagagccaacacgaaaccgcggtgatgagagaccctgaagagctttcggctgagcagggtctagaagattctggaagcttgtcaaggcagagcctagggaggacagtgagcagctgccagaggaagaacctgaagatcaacatccccctgacgacgccatgcaggacaatctctgcactcaccgacctcctccgggacgatctcgtcagccagcccaagaacaaatgcgactctgacgccggcatcacgttcacgaccatcaacaagacgaagctccggcacgccgagaagatgatcaagggcgccttcatcgagctctacaaaggtcttggatacctcacaacctaccggtaatttaatcaactgctaatctgtcatcctctaggaaatccatgtgtgttcagttcagattcagaagttcagaactgtttgtgtgatgtgaaatgcatgcaggaacctgaacatgatggcgttcgtgaagatcctgaagaagttcgagaaggttagcgggaagcaggtgctgtccgtatacctcagggcggtggagagctcctacttcaacagctccggcgaggctctgaagctgatggacgaggtggaggacgtgttcgtcaggcacttcgccgccggcaacaggcgcaaggccatgaagtacctcaagcccacgcaacggaaggagtcacacactgtcacattcttcatcggtaaacccaaaacaagaatctgcatgcagtttccactttgcaatgacaatctttgtaccactctgaatgtatgtatatgcagggctcatgacgggatgcttcgtggcgctgttcttgggctactgcatcatggcgcacatcgccggaatgtacacgcagcggcgcgactccatctacatggagaccgtctaccctgttttcaggtacacgcatgtagactctgcattttctgaaattctgcgttgatcgaatactgtatctgaattctgacatgaatggcaatggataattttgcagcatgttcagcctaatgttcctgcacctgttcatgtacgggtgcaacatggtggcgtggaggaaggcccggatcaactacagcttcatcttcgagttcgcggccggaagagagctcaagtaccgggacgtcttcctcgtctgcaccgcatccatggccgtcatcgtcggcgtcatgttcgcgcacctctccctcgccgtcaggggattccacgcccaggccatccccggattcttgctcctggtgaactcttctttcttgctccctcctgtcagactgtcgtcagtgtcacactgtcactgtcaacaaggaaccaaattaagaacatgcttttcttgctcattggatggacacgttgatcttgagttgttctcctgcaactggatcgtttcagaatgagaataatcatagtagtaatggaatctgttggtgctgcatgtctgaatgtaggggttcctgctgctgctgttctgcccattcaacatggtgtatcgctccactcggtttcagttcctcaggatactgaggaacatcgttttctcaccactctacaaggtaccacagtacatcttttctttttttttcttttgctaatctcttcatggagaataatgttgccaaattagtccaaattactacatatgttcttatatatcatgatggtttctgaatgtctgcaggttgtaatggtagacttcttcatggcagatcagctctgcagccaggtactactgaatatgctctacttaaaccactcaatccatgtcctgcattcaactgaaacctgaaaaaacaatggggataaacagataattaactttctgaaagaacaaaataaaaaatgcaggtgcctatgctaagaagcctcgagtacgtcgcttgctactacatcagtggaagctacagaacacaggagtacggatactgcatcaacaccaagcatatcagagatttggcctatgcagtttccttcctgccctactactggagagccatgcaggtcaagccccttatgtccttcacaattctcaattttcaaccatgctctttcaataaaaaaagaaaatgaaccatgcaaattttatgttccatatatcagcagtttggaatacacatttattgataaaatggaataaacacacacacaaaacaaaatgcactctgttcagctgaaaagaaaaactctctgaacttcctgaatatttctgaactttctgaaaatgtttgtgtatgttaatcagtgtgcaagacggtggttcgatgagagcgacacgggccacctggtaaacctgggcaagtacgtctcggcgatgctcgccgccggcgccaaagtggcctacgagaaggacaggagccttggatcactctcactcctcgtcatcgtctccagctctgcaacaatgtatcagctctactgggactttgtcaaggactggggcttgctccagcccaactccaagaatccatggctgaggaatgacctcatccttaagagcaagtccatatactacttgtcaatggtatgcatgttcgtcagtctatccccattcagacaggtgtataagcacagccaaaacgagttcatttgcagtagttcagtacaagctgcacgctcaaacacacactgtccaatcgacaaacccgactctcaatctctcaatcacagatcatcgataatgctcaaccgatatccaacctactatttaaaccacactatagtattgaaatggaaacgcaatttgatctgaatttgcaatgaatctgttccggggagaagtgaaccaaacactcaagtgttgtctgaacttttgcagggtctgaaccttgtgctaaggcttgcatggctacaaaccgtgatccatccaaactttgggagtttggactccagggtcacttcattctttctagctgctctcgaggtgatccggagagggcattggaatttctataggtaactgaagtttcagagttctgaacaaccacttatcctaaaaaataaaacagaaaaagcagtagcaggatttaggcaagaaaaatgagatcctgagacctgtggcatatgcttctttttttttttatatcaggctggagaacgagcatctgaacaatgcaggcaaattcagggcggtaaaaacagttccgctgccttttcacgaagctgacgaggaggactgatacgtgctacacaactgctgaatgatcatctgaccaagtgaccatgactagatctaatacttgtttcctcaccactcaattttttttttcaaaagagaaagtctcaagaatggtggagagttcagttcagtgactaaaatactttcactgaaataccttcagggttcagccttcagggaatggcaattgtatgcaactgaagacagtgatccgttcctagatgcattaacatgtataaaatacgcatcgcagtatcgcaaatgacatgaggttacttttgtttggcacc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0110100, RefSeq:Os01g0110100