Difference between revisions of "Os01g0109500"

From RiceWiki
Jump to: navigation, search
(Created page with "{{JaponicaGene| GeneName = Os01g0109500| Description = Conserved hypothetical protein| Version = NM_001048329.1 GI:115434071 GeneID:4326132| Length = 1391 bp| Definition ...")
 
Line 1: Line 1:
 +
Please input one-sentence summary here.
 +
 +
==Annotated Information==
 +
===Function===
 +
Please input function information here.
 +
 +
===Expression===
 +
Please input expression information here.
 +
 +
===Evolution===
 +
Please input evolution information here.
 +
 +
You can also add sub-section(s) at will.
 +
 +
==Labs working on this gene==
 +
Please input related labs here.
 +
 +
==References==
 +
Please input cited references here.
 +
 +
==Structured Information==
 
{{JaponicaGene|
 
{{JaponicaGene|
 
GeneName = Os01g0109500|
 
GeneName = Os01g0109500|

Revision as of 18:42, 22 July 2012

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0109500

Description

Conserved hypothetical protein

Version

NM_001048329.1 GI:115434071 GeneID:4326132

Length

1391 bp

Definition

Oryza sativa Japonica Group Os01g0109500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:509752..511142

Sequence Coding Region

509846..510556

Expression

GEO Profiles:Os01g0109500

Genome Context

<gbrowseImage1> name=NC_008394:509752..511142 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:509752..511142 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgttgaagagcagtagtacgatggagctggtgtcccgcatgtcgaagagcatgagcgtggccaacaacatcctcgccgtgcacgtcccccgcctgcacgccctacgcgccgccctcgacgggatccaggacgagccctcccgcgccgacctctcgtcctcctccgccgccaccgacgcctgcaggctcatccgggacaccgccgctggcctcacccacgccacgatccacctccacaacgccgcctactacctctcctccgtgctccgcatcgcgctgcgccacgccgacgccgacgcctccaccgacttctcctccaagctgccctcgctcgccgccaaccccttcccccgcctcgccgcccacctgctcgcctccatccccacgccgccgccgcagcccaccgcctgcaccctcgacgacgcgttgctcgcggtgtccgtcgtccacaacacgctcgcgctcctcctcgactacaaccttgagaggtgcatcctctacctccgcctcctcggccgccgcaacgaccccaatctccatcgccacaaccgcctgccgctggcccgcgaccgcctccgtgccgcctgcgtcatgttagacttcgccgccgcctactgcaacgtcgccgccaacgccatcaacgcccactacatcaagcttcaaaacgaggccagcttgattttcggttacacctggaacctaccctga</cdnaseq>

Protein Sequence

<aaseq>MALKSSSTMELVSRMSKSMSVANNILAVHVPRLHALRAALDGIQ DEPSRADLSSSSAATDACRLIRDTAAGLTHATIHLHNAAYYLSSVLRIALRHADADAS TDFSSKLPSLAANPFPRLAAHLLASIPTPPPQPTACTLDDALLAVSVVHNTLALLLDY NLERCILYLRLLGRRNDPNLHRHNRLPLARDRLRAACVMLDFAAAYCNVAANAINAHY IKLQNEASLIFGYTWNLP</aaseq>

Gene Sequence

<dnaseqindica>95..805#cttcttcctctgatagatagatcttcttcttcttcttcgcgtcacatttggatcttcttcatcttcatctgagagagatcagggcggggcggcaatggcgttgaagagcagtagtacgatggagctggtgtcccgcatgtcgaagagcatgagcgtggccaacaacatcctcgccgtgcacgtcccccgcctgcacgccctacgcgccgccctcgacgggatccaggacgagccctcccgcgccgacctctcgtcctcctccgccgccaccgacgcctgcaggctcatccgggacaccgccgctggcctcacccacgccacgatccacctccacaacgccgcctactacctctcctccgtgctccgcatcgcgctgcgccacgccgacgccgacgcctccaccgacttctcctccaagctgccctcgctcgccgccaaccccttcccccgcctcgccgcccacctgctcgcctccatccccacgccgccgccgcagcccaccgcctgcaccctcgacgacgcgttgctcgcggtgtccgtcgtccacaacacgctcgcgctcctcctcgactacaaccttgagaggtgcatcctctacctccgcctcctcggccgccgcaacgaccccaatctccatcgccacaaccgcctgccgctggcccgcgaccgcctccgtgccgcctgcgtcatgttagacttcgccgccgcctactgcaacgtcgccgccaacgccatcaacgcccactacatcaagcttcaaaacgaggccagcttgattttcggttacacctggaacctaccctgatcaatcgtcttcttttctctcctcttctccgtcgatctacgtacgttagcacgcacgcatgccaagttagcatttccattatactattgcctagtagcttgttaagaactaattgcttcaattcaaaccttcaatttcacaaattaattaattatttgctcctgcttagctaattaatttcctcttcttctgtgacttgatataggtacagctggatcgaggagagggaggcgaattgatcgacggatcatcaattgaacagcttaaggatccccagcttcttattaattggtccaattcaggctcaagcccggccgcttttctttttctaatttcttttcccttcttatcatctgcgctgtgtctggttcatcgattgatccatcatcaggtggtcaatctggagtagttagtatactagtagcagtaattctgagtcttttggactgcacgactacttaattttggagtatccatccagcttttaattaccaagcagtactacaaacctgtctttggagtagtagacaaagaaaaagttgtaggtagacgggcagatcaattacattctacgcctgttatgatc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0109500, RefSeq:Os01g0109500