Os01g0106400

From RiceWiki
Revision as of 04:16, 25 June 2012 by 127.0.0.1 (talk) (Created page with "{{JaponicaGene| GeneName = Os01g0106400| Description = Similar to Isoflavone reductase homolog IRL (EC 1.3.1.-)| Version = NM_001048311.1 GI:115434035 GeneID:4326149| Leng...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gene Name

Os01g0106400

Description

Similar to Isoflavone reductase homolog IRL (EC 1.3.1.-)

Version

NM_001048311.1 GI:115434035 GeneID:4326149

Length

1323 bp

Definition

Oryza sativa Japonica Group Os01g0106400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:326128..327450

Sequence Coding Region

326337..326500,326618..327398

Expression

GEO Profiles:Os01g0106400

Genome Context

<gbrowseImage1> name=NC_008394:326128..327450 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:326128..327450 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgtccggtggcgaggagaagaagagcaggatcctggtggtgggcggcacggggtacatcggccggcacgtcgtcttggccagcgcgcggctgggtcatcccaccaccgccctcgtcagggacctctccccctccgaccccgccaagtcgcagcttctccagagcttccgcgacgccggcgtcaccctcctccacggcgacctctacgaccacgccagcctgctcagcgccgtccgcgacgccgacgtcgtcatctccacgctgggcgcgctgcagatcgccgaccagaccaagctcatcgccgccatcaaggagggcggcggtggcaacgtgcggaggttcctgccgtcggagttcgggctggacccggaccacacgggcgcggtggagccggccaggtccatcttcaccgggaaggccgccgtgcggcgcgccgtggaggcggcgggagtgccgtacacgtacgtggtgtccaactacttcgccggctacgcgctgccgacgatcgggcagaacctgccgccggcgcggccggtggatagcgtggtgatcctcggggacggagccaccaaggtggtgttcgtggaggagggggacatcgggacgtacacggtgctggcggcggtggatccgcgggcggagaacaagacggtgaacatacggccggcgaagaacgcggtgtcgcacgaggagctggtggcgctgtgggagaagaagacggggaagaagctggagagggtgtacgtgcccgaggacgccgtgctcaagcaaatccaggagtcggagatcccgttgaacatcgtgctgtcgatcgcgcacgcagggtacataaggggggagacgacgacgccgttggatccagccaccgccgttgaggccacccagctcttcccggacgtccagtacaccaccgtcgatgactacctcaacaggctcctctga</cdnaseq>

Protein Sequence

<aaseq>MASGGEEKKSRILVVGGTGYIGRHVVLASARLGHPTTALVRDLS PSDPAKSQLLQSFRDAGVTLLHGDLYDHASLLSAVRDADVVISTLGALQIADQTKLIA AIKEGGGGNVRRFLPSEFGLDPDHTGAVEPARSIFTGKAAVRRAVEAAGVPYTYVVSN YFAGYALPTIGQNLPPARPVDSVVILGDGATKVVFVEEGDIGTYTVLAAVDPRAENKT VNIRPAKNAVSHEELVALWEKKTGKKLERVYVPEDAVLKQIQESEIPLNIVLSIAHAG YIRGETTTPLDPATAVEATQLFPDVQYTTVDDYLNRLL</aaseq>

Gene Sequence

<dnaseqindica>951..1114#53..833#gcaagctgtgacacactaacactctacttgtactaggtagatcgctagaacaatggcgtccggtggcgaggagaagaagagcaggatcctggtggtgggcggcacggggtacatcggccggcacgtcgtcttggccagcgcgcggctgggtcatcccaccaccgccctcgtcagggacctctccccctccgaccccgccaagtcgcagcttctccagagcttccgcgacgccggcgtcaccctcctccacggcgacctctacgaccacgccagcctgctcagcgccgtccgcgacgccgacgtcgtcatctccacgctgggcgcgctgcagatcgccgaccagaccaagctcatcgccgccatcaaggagggcggcggtggcaacgtgcggaggttcctgccgtcggagttcgggctggacccggaccacacgggcgcggtggagccggccaggtccatcttcaccgggaaggccgccgtgcggcgcgccgtggaggcggcgggagtgccgtacacgtacgtggtgtccaactacttcgccggctacgcgctgccgacgatcgggcagaacctgccgccggcgcggccggtggatagcgtggtgatcctcggggacggagccaccaaggtggtgttcgtggaggagggggacatcgggacgtacacggtgctggcggcggtggatccgcgggcggagaacaagacggtgaacatacggccggcgaagaacgcggtgtcgcacgaggagctggtggcgctgtgggagaagaagacggggaagaagctggagagggtgtacgtgcccgaggacgccgtgctcaagcaaatccagggtaacgtactatgttccatatgtactctctccatcctaaattctaatacaacgaatcgtatccaatattaagttagttttttatccgtccatggctaattgcatggtttggttgcagagtcggagatcccgttgaacatcgtgctgtcgatcgcgcacgcagggtacataaggggggagacgacgacgccgttggatccagccaccgccgttgaggccacccagctcttcccggacgtccagtacaccaccgtcgatgactacctcaacaggctcctctgaaatacatcgatacatccatcatcttttatgtgccaataaaataattaagtctcttccttagtaatgtacatgttcctgcaaatttcacaccgtcggtgagagtgagtgtcttggtttaatctgtcatggatcactgtgctcagttcagctcttcttcagggcttgatttgcatgttaatgaatttatttgcttaaacattattagtatg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0106400, RefSeq:Os01g0106400