Difference between revisions of "Os01g0106400"

From RiceWiki
Jump to: navigation, search
 
(One intermediate revision by one other user not shown)
Line 1: Line 1:
Please input one-sentence summary here.
+
The rice '''''Os01g0106400''''' was reported as '''''OsIRL''''' in 2009 <ref name="ref1" /> by researchers from Korea.  
  
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
* '''''OsIRL''''' plays an important role in homeostasis of ROS.
 +
 
 +
===Phenotypic analysis===
 +
* '''''OsIRL''''' transgenic rice line activated by ABA treatment was tolerant against MV and G/GO-induced stress in rice leave and suspension-cultured cells.
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
* Using Northern and Western blot analyses, the '''''OsIRL''''' gene and protein were shown to be down-regulated in young seedling roots treated with reduced glutathione (GSH) and diphenyleneiodonium (DPI), known quenchers of reactive oxygen species (ROS).  
 
+
* The OsIRL transcript level in rice suspension-cultured cells was also found to be induced by oxidants such as hydrogen peroxide (H2O2 ), ferric chloride (FeCl3), methyl viologen (MV) and glucose/glucose oxidase (G/GO), but down-regulated when co-treated with GSH.
===Evolution===
 
Please input evolution information here.
 
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
* Environmental Biotechnology National Core Research Center, Gyeongsang National University, Jinju 660-701, Korea
 +
* Department of Chemistry and Biochemistry and Institute of Biomedical Studies, Baylor University, Waco, TX 76798-7348, USA
 +
* Department of Plant Bioscience, Pusan National University, Miryang 627-706, Korea
 +
* Division of Applied Life Science (BK21 program), Gyeongsang National University, Jinju 660-701, Korea
 +
* Department of Crop Sciences, University of Illinois, 1102 S. Goodwin Avenue, Urbana, IL 61801, USA
 +
* Department of Life Science and Environmental Biochemistry, Pusan National University, Miryang 627-706, Korea
 +
* Division of Bioscience and Bioinformatics, Myongji University, Yongin 449-728, Korea
 +
* Plant Molecular Biology and Biotechnology Research Center, Gyeongsang National University, Jinju 660-701, Korea
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
* <ref name="ref1">
 +
Kim SG, Kim ST, Wang Y, Kim SK, Lee CH, Kim KK, Kim JK, Lee SY, Kang KY.
 +
Overexpression of rice isoflavone reductase-like gene (OsIRL) confers tolerance
 +
to reactive oxygen species. Physiol Plant. 2010 Jan;138(1):1-9. doi:
 +
10.1111/j.1399-3054.2009.01290.x. PubMed PMID: 19825006.
 +
</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==
{{JaponicaGene|
+
    [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
GeneName = Os01g0106400|
 
Description = Similar to Isoflavone reductase homolog IRL (EC 1.3.1.-)|
 
Version = NM_001048311.1 GI:115434035 GeneID:4326149|
 
Length = 1323 bp|
 
Definition = Oryza sativa Japonica Group Os01g0106400, complete gene.|
 
Source = Oryza sativa Japonica Group
 
 
 
  ORGANISM  Oryza sativa Japonica Group
 
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
 
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
 
            clade; Ehrhartoideae; Oryzeae; Oryza.
 
|
 
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
 
AP = Chromosome 1:326128..327450|
 
CDS = 326337..326500,326618..327398|
 
GCID = <gbrowseImage1>
 
name=NC_008394:326128..327450
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage1>|
 
GSID = <gbrowseImage2>
 
name=NC_008394:326128..327450
 
source=RiceChromosome01
 
preset=GeneLocation
 
</gbrowseImage2>|
 
CDNA = <cdnaseq>atggcgtccggtggcgaggagaagaagagcaggatcctggtggtgggcggcacggggtacatcggccggcacgtcgtcttggccagcgcgcggctgggtcatcccaccaccgccctcgtcagggacctctccccctccgaccccgccaagtcgcagcttctccagagcttccgcgacgccggcgtcaccctcctccacggcgacctctacgaccacgccagcctgctcagcgccgtccgcgacgccgacgtcgtcatctccacgctgggcgcgctgcagatcgccgaccagaccaagctcatcgccgccatcaaggagggcggcggtggcaacgtgcggaggttcctgccgtcggagttcgggctggacccggaccacacgggcgcggtggagccggccaggtccatcttcaccgggaaggccgccgtgcggcgcgccgtggaggcggcgggagtgccgtacacgtacgtggtgtccaactacttcgccggctacgcgctgccgacgatcgggcagaacctgccgccggcgcggccggtggatagcgtggtgatcctcggggacggagccaccaaggtggtgttcgtggaggagggggacatcgggacgtacacggtgctggcggcggtggatccgcgggcggagaacaagacggtgaacatacggccggcgaagaacgcggtgtcgcacgaggagctggtggcgctgtgggagaagaagacggggaagaagctggagagggtgtacgtgcccgaggacgccgtgctcaagcaaatccaggagtcggagatcccgttgaacatcgtgctgtcgatcgcgcacgcagggtacataaggggggagacgacgacgccgttggatccagccaccgccgttgaggccacccagctcttcccggacgtccagtacaccaccgtcgatgactacctcaacaggctcctctga</cdnaseq>|
 
AA = <aaseq>MASGGEEKKSRILVVGGTGYIGRHVVLASARLGHPTTALVRDLS                    PSDPAKSQLLQSFRDAGVTLLHGDLYDHASLLSAVRDADVVISTLGALQIADQTKLIA                    AIKEGGGGNVRRFLPSEFGLDPDHTGAVEPARSIFTGKAAVRRAVEAAGVPYTYVVSN                    YFAGYALPTIGQNLPPARPVDSVVILGDGATKVVFVEEGDIGTYTVLAAVDPRAENKT                    VNIRPAKNAVSHEELVALWEKKTGKKLERVYVPEDAVLKQIQESEIPLNIVLSIAHAG                    YIRGETTTPLDPATAVEATQLFPDVQYTTVDDYLNRLL</aaseq>|
 
DNA = <dnaseqindica>951..1114#53..833#gcaagctgtgacacactaacactctacttgtactaggtagatcgctagaacaatggcgtccggtggcgaggagaagaagagcaggatcctggtggtgggcggcacggggtacatcggccggcacgtcgtcttggccagcgcgcggctgggtcatcccaccaccgccctcgtcagggacctctccccctccgaccccgccaagtcgcagcttctccagagcttccgcgacgccggcgtcaccctcctccacggcgacctctacgaccacgccagcctgctcagcgccgtccgcgacgccgacgtcgtcatctccacgctgggcgcgctgcagatcgccgaccagaccaagctcatcgccgccatcaaggagggcggcggtggcaacgtgcggaggttcctgccgtcggagttcgggctggacccggaccacacgggcgcggtggagccggccaggtccatcttcaccgggaaggccgccgtgcggcgcgccgtggaggcggcgggagtgccgtacacgtacgtggtgtccaactacttcgccggctacgcgctgccgacgatcgggcagaacctgccgccggcgcggccggtggatagcgtggtgatcctcggggacggagccaccaaggtggtgttcgtggaggagggggacatcgggacgtacacggtgctggcggcggtggatccgcgggcggagaacaagacggtgaacatacggccggcgaagaacgcggtgtcgcacgaggagctggtggcgctgtgggagaagaagacggggaagaagctggagagggtgtacgtgcccgaggacgccgtgctcaagcaaatccagggtaacgtactatgttccatatgtactctctccatcctaaattctaatacaacgaatcgtatccaatattaagttagttttttatccgtccatggctaattgcatggtttggttgcagagtcggagatcccgttgaacatcgtgctgtcgatcgcgcacgcagggtacataaggggggagacgacgacgccgttggatccagccaccgccgttgaggccacccagctcttcccggacgtccagtacaccaccgtcgatgactacctcaacaggctcctctgaaatacatcgatacatccatcatcttttatgtgccaataaaataattaagtctcttccttagtaatgtacatgttcctgcaaatttcacaccgtcggtgagagtgagtgtcttggtttaatctgtcatggatcactgtgctcagttcagctcttcttcagggcttgatttgcatgttaatgaatttatttgcttaaacattattagtatg</dnaseqindica>|
 
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048311.1 RefSeq:Os01g0106400]|
 
}}
 
[[Category:Genes]]
 
[[Category:Japonica mRNA]]
 
[[Category:Oryza Sativa Japonica Group]]
 
[[Category:Japonica Genes]]
 
[[Category:Japonica Chromosome 1]]
 
[[Category:Chromosome 1]]
 

Latest revision as of 02:38, 18 February 2017

The rice Os01g0106400 was reported as OsIRL in 2009 [1] by researchers from Korea.

Annotated Information

Function

  • OsIRL plays an important role in homeostasis of ROS.

Phenotypic analysis

  • OsIRL transgenic rice line activated by ABA treatment was tolerant against MV and G/GO-induced stress in rice leave and suspension-cultured cells.

Expression

  • Using Northern and Western blot analyses, the OsIRL gene and protein were shown to be down-regulated in young seedling roots treated with reduced glutathione (GSH) and diphenyleneiodonium (DPI), known quenchers of reactive oxygen species (ROS).
  • The OsIRL transcript level in rice suspension-cultured cells was also found to be induced by oxidants such as hydrogen peroxide (H2O2 ), ferric chloride (FeCl3), methyl viologen (MV) and glucose/glucose oxidase (G/GO), but down-regulated when co-treated with GSH.

You can also add sub-section(s) at will.

Labs working on this gene

  • Environmental Biotechnology National Core Research Center, Gyeongsang National University, Jinju 660-701, Korea
  • Department of Chemistry and Biochemistry and Institute of Biomedical Studies, Baylor University, Waco, TX 76798-7348, USA
  • Department of Plant Bioscience, Pusan National University, Miryang 627-706, Korea
  • Division of Applied Life Science (BK21 program), Gyeongsang National University, Jinju 660-701, Korea
  • Department of Crop Sciences, University of Illinois, 1102 S. Goodwin Avenue, Urbana, IL 61801, USA
  • Department of Life Science and Environmental Biochemistry, Pusan National University, Miryang 627-706, Korea
  • Division of Bioscience and Bioinformatics, Myongji University, Yongin 449-728, Korea
  • Plant Molecular Biology and Biotechnology Research Center, Gyeongsang National University, Jinju 660-701, Korea

References

  1. Kim SG, Kim ST, Wang Y, Kim SK, Lee CH, Kim KK, Kim JK, Lee SY, Kang KY. Overexpression of rice isoflavone reductase-like gene (OsIRL) confers tolerance to reactive oxygen species. Physiol Plant. 2010 Jan;138(1):1-9. doi: 10.1111/j.1399-3054.2009.01290.x. PubMed PMID: 19825006.

Structured Information