Os01g0100500

From RiceWiki
Revision as of 04:15, 25 June 2012 by 127.0.0.1 (talk) (Created page with "{{JaponicaGene| GeneName = Os01g0100500| Description = Immunoglobulin-like domain containing protein| Version = NM_001048271.1 GI:115433955 GeneID:4326455| Length = 3746 b...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gene Name

Os01g0100500

Description

Immunoglobulin-like domain containing protein

Version

NM_001048271.1 GI:115433955 GeneID:4326455

Length

3746 bp

Definition

Oryza sativa Japonica Group Os01g0100500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:15399..19144

Sequence Coding Region

15599..15976,16383..16474,16558..17258,17501..17571,17968..18057
,18142..18321,18531..18593

Expression

GEO Profiles:Os01g0100500

Genome Context

<gbrowseImage1> name=NC_008394:15399..19144 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:15399..19144 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgtgcacggcggcgcgcatgttcgcctccaacgccaccctctgcgcctgcgagccgggcttctacctctccgccgccatcaacggcacctgcctcggcctgcccgacggcggctggcaggtcggctccgtcggcgcctcccgcaaccagagcttctacttcctcacccccgtcctctccctcgacgtcgtccgccgcctcacccagtcccaggccctcctcctcgaggccaccatcgctgccctcctctcctggcttgccttttgtgccttcgccaggttcaccggacacgaccccaccggcaacaagaggctcttccgcgcgcgcttctgggtcagccgcctcgactgcatctacgacaccacccactgggcggatgaccagcaagtactgaggaaaagaaaaacagagttgggtggtacgtgctcagtagctagcttgatactcttcgttggattagtcactgtgctgctgtaccaagccatccaaagacgcaacattgaagtgcatcgggtcaaaccagccaatgctcctgatttgttgtcttttgtcaatgatatcgagttccacataaccaccatctctagcatgtcttgctctcagttggttgccccttctacaattgcaatgggaacacctggatctatggacttcaggctgctgcctttgtcaacattgttgacatacaattgccagaacacgagccaggggccatctgtttcactcaagtgcaatggctgcagaatcccgccaagagaccactacgtatcctggcaatttattgacctgccaaggcaaccagctgccgctgttggcttccagtttaatctcactgcgaagcaacatggagatgacaaacatgtgagctctgtcagtggaactataaactccgacaattttactgatgacaagctgaagacattcagagggagagattccaatgtgctcaagattcaattgtttcctcaaacatacatcaatcatcacaatttgaagcttctgcaacctctggttcaggacttcactcaaggttctaccttttcaaatgttagaaacttgaatgcttccttgcaaaaccctatggatggaataataaatactacactctacataagctatctttccaactacattgtggagattagcaacgaaaatgtgctaggcccagtcagtatacttgcaagtattggtggcctttatgccttcagtgtggcaatatttctttgccttatggctcaatgtgaagctaggataaaaaagcttcgagacgaggattccagaatgctaaaaatactgaggaaaagacgtgctcaacagaattgggataaggtgaggaagtttgtcatgtatacctggggccctagcaacttggatccaagtgatagaagtggcaaatggcctgaaagttcagtgatggattctctccatggatccttccacaagaaaagaaaaccgattagacgagcaacctcgaatggtaacaaacctaagagaaatcctgctgacgcgggagttattgacatcgaaagagttggggaaatgcaggagtcgagtagttctagacaggcttaa</cdnaseq>

Protein Sequence

<aaseq>MACTAARMFASNATLCACEPGFYLSAAINGTCLGLPDGGWQVGS VGASRNQSFYFLTPVLSLDVVRRLTQSQALLLEATIAALLSWLAFCAFARFTGHDPTG NKRLFRARFWVSRLDCIYDTTHWADDQQVLRKRKTELGGTCSVASLILFVGLVTVLLY QAIQRRNIEVHRVKPANAPDLLSFVNDIEFHITTISSMSCSQLVAPSTIAMGTPGSMD FRLLPLSTLLTYNCQNTSQGPSVSLKCNGCRIPPRDHYVSWQFIDLPRQPAAAVGFQF NLTAKQHGDDKHVSSVSGTINSDNFTDDKLKTFRGRDSNVLKIQLFPQTYINHHNLKL LQPLVQDFTQGSTFSNVRNLNASLQNPMDGIINTTLYISYLSNYIVEISNENVLGPVS ILASIGGLYAFSVAIFLCLMAQCEARIKKLRDEDSRMLKILRKRRAQQNWDKVRKFVM YTWGPSNLDPSDRSGKWPESSVMDSLHGSFHKKRKPIRRATSNGNKPKRNPADAGVID IERVGEMQESSSSRQA</aaseq>

Gene Sequence

<dnaseqindica>201..578#985..1076#1160..1860#2103..2173#2570..2659#2744..2923#3133..3195#gcagcaggcgaggagaggcaaccagagggagggtaggttggtttggaaggaaggaaggagaagagataaacaagttaggaggagacaagcatccgattccgaactttgatggatcccctccatatctatcttcccatccaatccaatctctgccctcaattgagattcgagagctaagctaagccacgccaaattaagccatggcgtgcacggcggcgcgcatgttcgcctccaacgccaccctctgcgcctgcgagccgggcttctacctctccgccgccatcaacggcacctgcctcggcctgcccgacggcggctggcaggtcggctccgtcggcgcctcccgcaaccagagcttctacttcctcacccccgtcctctccctcgacgtcgtccgccgcctcacccagtcccaggccctcctcctcgaggccaccatcgctgccctcctctcctggcttgccttttgtgccttcgccaggttcaccggacacgaccccaccggcaacaagaggctcttccgcgcgcgcttctgggtcagccgcctcgactgcatctacgacaccacccactgggcggttagttttctttttttccccttttttttactaataacatcttgtttcttacaaatttcttttgccctcgccgaacttagattttcatcaaggccaaattaattgcttttgagtccttctactcatgtcgaaattgaggattgctttgcttcgcttgttaggaatctcctctcctaaggaacaagtttttgctttgctactactttaatttcttatccatcacactccttttgccgctccttcctacttcggcacattgcactttcttaccagtattagatattggatatggatattatacattatacactacgaacactccttatatccaaggaaatttattttctgcactaatttctacttttccaagttgcattgaatattgatgtaccttgccgtactgtaggatgaccagcaagtactgaggaaaagaaaaacagagttgggtggtacgtgctcagtagctagcttgatactcttcgttggattagtcactgtgtaagtgcttaacaaagtctagtgttggaaggaatttgttactcactcactaacagggtgtcttctttccttgcttgttgcaggctgctgtaccaagccatccaaagacgcaacattgaagtgcatcgggtcaaaccagccaatgctcctgatttgttgtcttttgtcaatgatatcgagttccacataaccaccatctctagcatgtcttgctctcagttggttgccccttctacaattgcaatgggaacacctggatctatggacttcaggctgctgcctttgtcaacattgttgacatacaattgccagaacacgagccaggggccatctgtttcactcaagtgcaatggctgcagaatcccgccaagagaccactacgtatcctggcaatttattgacctgccaaggcaaccagctgccgctgttggcttccagtttaatctcactgcgaagcaacatggagatgacaaacatgtgagctctgtcagtggaactataaactccgacaattttactgatgacaagctgaagacattcagagggagagattccaatgtgctcaagattcaattgtttcctcaaacatacatcaatcatcacaatttgaagcttctgcaacctctggttcaggacttcactcaaggttctaccttttcaaatgttagaaacttgaatgcttccttgcaaaaccctatggatggaataataaatactacactctacataagctatctttccaactacattgtggagattagcaacgaaaatgtgctaggcccaggtgagcttttctagtgattgttgatacctacataagtcatctttccagcctattgaaaatgaagtctctttacttgtgaattgtggtgttaatgttactaagatttacgctactaagtaccaatacaaatatttgaaatcccggtgcaaatattttctccatgatggcttttttaaatttttgggcttctactaatctgaatagtttgtattactagtatctaatatgcttattttctgcagtcagtatacttgcaagtattggtggcctttatgccttcagtgtggcaatatttctttgccttatggctcaagtaagtcatcacaaatctatccctgttgtttgtttaagataaactgccagttttttttttcactttcgagttttaactagcctaacacttgttgacctctgaatctttgcatctttatggggttttctgttccactcagaattactaataggccatgaaaattttctgatattttttaaatgaattgaattaacatacttgcaatttccgctcattatcatggttcaaggcgtgtgctctggtgcacatccttcctcgacagccagctgtcgatgtaaaacttttcttgtaaccttttcttcctatcttaattacattgaatgacctccttcggtcattccggcaaaaaagaagatgacttagtatgcagctgtaattgatgctttgtctttccagtgtgaagctaggataaaaaagcttcgagacgaggattccagaatgctaaaaatactgaggaaaagacgtgctcaacagaattgggataaggtgaagaatgtcctgatctaatgatgaacattgtacctactagactgcatccctgatcaagcatatcatttttcttcctaataggtgaggaagtttgtcatgtatacctggggccctagcaacttggatccaagtgatagaagtggcaaatggcctgaaagttcagtgatggattctctccatggatccttccacaagaaaagaaaaccgattagacgagcaacctcgaatggtaacaaacctaagagaaatcctgctgacgcggtaaagtaactgtccttttcaactactctttatggcactatttatacatttgccattcaatacagtaaaatacgtttataccagaaaaagggtaccctgtgtacatttttcgatactctttttttttacttcattctttctctgacaaggttttacttcattccttgttgaatgattatcttatttttcctgtttcaatgatatcacagggagttattgacatcgaaagagttggggaaatgcaggagtcgagtagttctagacaggcttaatggatgaaagctgtggatgctattggtcattgaaatgtgattgctcttagtctctgactcatggctgattctacacaaatgtgcttgtaatttttatccctttcaatagttccgcataaagaatttttttgttgcagcagcatcattggagcggcataccgtggcttggctatatggcaggtccaacacaaccgtactaccagagaggttttcttgtatgtatgttgcaacaaatggggagaaatgtacggagttttaactattaatcagcatgttggctgctgccgaggtcaggccagaatcctctttgattttcatgggacttcgtttcttgagttgtcgaacactgtatataccttcaccagttaccaccctccacgtgcaattacagtggggaagaaacagaaagatgcctatcatttctctatatgaagcagatggtggcatttgtattttaatttattacatcgtgtcatcgtgtaaatcttcgtgttggtgtgattcgccgaccgttttctagccggctgattatatatgccaaacttatactc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0100500, RefSeq:Os01g0100500