Os01g0100400

From RiceWiki
Revision as of 18:42, 22 July 2012 by 124.16.129.48 (talk)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0100400

Description

Pectinesterase-like protein

Version

NM_001048270.1 GI:115433953 GeneID:4326454

Length

2965 bp

Definition

Oryza sativa Japonica Group Os01g0100400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:11721..14685

Sequence Coding Region

11774..12813,12906..13271,13359..13437,13969..14171,14266..14359

Expression

GEO Profiles:Os01g0100400

Genome Context

<gbrowseImage1> name=NC_008394:11721..14685 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:11721..14685 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggattcgattcgccgtcgatctgccggaggcatcctcggcatcctctttctggtgctgctccggtgggcgggggcgggggatccctatgcctactacgagtgggaggtatcgtacgtgtggggtgcgccgctgggcggagtgaagaagcaggaggcgattggcatcaacgggcagctgccggggccggcgctgaacgtgacgaccaactggaacctggtggtgaacgtgaggaacggcctggacgagccgctgctgctgacgtggcacggggtgcagcagcgcaagagcccctggcaggacggcgtgggcggcacaaactgcggcatcccgccggggtggaactggacgtaccagttccaggtgaaggaccaggtcggcagcttcttctacgccccctccaccgccctccaccgcgccgccggcggctacggcgccatcaccatcaacaaccgcgacgtcatccccttgcccttccccctccccgacggcggcgacatcaccctcttcctcgccgactggtacgccagggaccacagggccctgcgccgcgccctcgacgccggcgaccccctcggcccccccgacggggtgctcatcaacgccctcggcccctaccgctacaacgacaccctcgtcccgccgggcgtcacctacgagcgcatcaatgtcgacccggggaggacctaccgcctgcgcgtccacaacgtcggcgtcgccaccagcctcaatttcagaatccagggccacaacctgctgctcgtcgaggccgagggctcctacacttcacagcagaactacaccaacatggacatccatgtcggccagtcctactccttccttctcaccatggaccagaacgcctccaccgactactacgtcgtcgccagcgcccgtttcgtccccgacgccgacaagctcaccggcgtcgccatcctccactactccaactcccagggcccgccctctggctctctccctgatgccccagatgaccagtacgacaccgctttctccatcaaccaagcaagatcaatcagatggaatgttacagccagtggtgcccgccccaatccgcagggctcattccattacggcgacattaccgtcaccgatgtgtacctgctgcagagcatgccaccggagctcatagacggccagatgcgtgctactctcaatggaatttcttatattgctccatcgactcctttgatgctcgctcagctctttaatgtcccgggagtctacaaactggattttcctaatcgtcctatgaacaggttaccaaagcttgacacctccattatcaatggcacctacaaaggctttatggagatcatattccaaaacaacgccacatccgtgcagagctaccacttggatggatatgcattctttgttgttgggatggactatggactgtggacagacaacagccgcggtacatacaacaaatgggatggcgttgcacgctccacaattcaggtattccctggcgcttggacggctgtccttgtctttcttgacaatgcgggtatatggaatctgcgggtggagaacctggacgcctggtacctggggcaagaagtgtacatcagtgtggttaacccggaggatagcagcaacaagaccgtgcttcctcttcccgacaacgcgattttctgtggtgcgctgtcaagtttacaaaaggagcaatcgcatagattccaatactcagaagcttctcagataacgcagctgtggaagatggttttcttcatggcatggttggccctttggtag</cdnaseq>

Protein Sequence

<aaseq>MDSIRRRSAGGILGILFLVLLRWAGAGDPYAYYEWEVSYVWGAP LGGVKKQEAIGINGQLPGPALNVTTNWNLVVNVRNGLDEPLLLTWHGVQQRKSPWQDG VGGTNCGIPPGWNWTYQFQVKDQVGSFFYAPSTALHRAAGGYGAITINNRDVIPLPFP LPDGGDITLFLADWYARDHRALRRALDAGDPLGPPDGVLINALGPYRYNDTLVPPGVT YERINVDPGRTYRLRVHNVGVATSLNFRIQGHNLLLVEAEGSYTSQQNYTNMDIHVGQ SYSFLLTMDQNASTDYYVVASARFVPDADKLTGVAILHYSNSQGPPSGSLPDAPDDQY DTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVYLLQSMPPELIDGQMRATL NGISYIAPSTPLMLAQLFNVPGVYKLDFPNRPMNRLPKLDTSIINGTYKGFMEIIFQN NATSVQSYHLDGYAFFVVGMDYGLWTDNSRGTYNKWDGVARSTIQVFPGAWTAVLVFL DNAGIWNLRVENLDAWYLGQEVYISVVNPEDSSNKTVLPLPDNAIFCGALSSLQKEQS HRFQYSEASQITQLWKMVFFMAWLALW</aaseq>

Gene Sequence

<dnaseqindica>54..1093#1186..1551#1639..1717#2249..2451#2546..2639#actcgccgtcaccccccaccttgacctccgcttcgaattcgaattcgaatccgatggattcgattcgccgtcgatctgccggaggcatcctcggcatcctctttctggtgctgctccggtgggcgggggcgggggatccctatgcctactacgagtgggaggtatcgtacgtgtggggtgcgccgctgggcggagtgaagaagcaggaggcgattggcatcaacgggcagctgccggggccggcgctgaacgtgacgaccaactggaacctggtggtgaacgtgaggaacggcctggacgagccgctgctgctgacgtggcacggggtgcagcagcgcaagagcccctggcaggacggcgtgggcggcacaaactgcggcatcccgccggggtggaactggacgtaccagttccaggtgaaggaccaggtcggcagcttcttctacgccccctccaccgccctccaccgcgccgccggcggctacggcgccatcaccatcaacaaccgcgacgtcatccccttgcccttccccctccccgacggcggcgacatcaccctcttcctcgccgactggtacgccagggaccacagggccctgcgccgcgccctcgacgccggcgaccccctcggcccccccgacggggtgctcatcaacgccctcggcccctaccgctacaacgacaccctcgtcccgccgggcgtcacctacgagcgcatcaatgtcgacccggggaggacctaccgcctgcgcgtccacaacgtcggcgtcgccaccagcctcaatttcagaatccagggccacaacctgctgctcgtcgaggccgagggctcctacacttcacagcagaactacaccaacatggacatccatgtcggccagtcctactccttccttctcaccatggaccagaacgcctccaccgactactacgtcgtcgccagcgcccgtttcgtccccgacgccgacaagctcaccggcgtcgccatcctccactactccaactcccagggcccgccctctggctctctccctgatgccccagatgaccagtacgacaccgctttctccatcaaccaagcaagatcaatcaggtcagtagcctgcattgccattactgctcatccattcattcatcggtcctactcactctcattgactctctctctctctcacacacacccagatggaatgttacagccagtggtgcccgccccaatccgcagggctcattccattacggcgacattaccgtcaccgatgtgtacctgctgcagagcatgccaccggagctcatagacggccagatgcgtgctactctcaatggaatttcttatattgctccatcgactcctttgatgctcgctcagctctttaatgtcccgggagtctacaaactggattttcctaatcgtcctatgaacaggttaccaaagcttgacacctccattatcaatggcacctacaaaggctttatggagatcatattccaaaacaacgccacatccgtgcagagctaccacttggatggatatgcattctttgttgttgggtaaaagcttgcagcactccccctttcccctgccctggatgtactacttatttacttatatatggatatggtggttacttctctcaggatggactatggactgtggacagacaacagccgcggtacatacaacaaatgggatggcgttgcacgctccacaattcaggtgctcaaaattttcatgtctcccattgctttctatggatgccggtttttaactatgacacctggtagctagtctgctgcctgaaacccaaagaaactagtactgtgctattacatctgttacttgatggagatggaagttagcagccgatatgtgggactcgtactatgtagtaacagagcggcacggtgcaccttcttgtagaaaaatcatgtatgtctttctatgggggtggttagttttttgaggggatgttgtcatatatccatatcattcagatatggagtggctaattatgtggtcaaccaatgattcctttgggcatggcagttttgatggtatagaaaccctcattgtttgtttggttagtgataaacttcatgcactggttcaaagtttcagacgactgcattttatcttgagaaaaccttcgaattcaggaaatactgtctgaaatataacctactcatgaactctatacaatattctggtacagcctttagcttgacatgtctttgtgcaagactgcaggtattccctggcgcttggacggctgtccttgtctttcttgacaatgcgggtatatggaatctgcgggtggagaacctggacgcctggtacctggggcaagaagtgtacatcagtgtggttaacccggaggatagcagcaacaagaccgtgcttcctcttcccgacaacgcgattttctgtggtgcgctgtcaagtttacaaaagtgaggcttctcatgacagcggttttcagtttgcagctcagggatgcctacctgttatataacatgtatagcgtttgttgttgattccgtgcagggagcaatcgcatagattccaatactcagaagcttctcagataacgcagctgtggaagatggttttcttcatggcatggttggccctttggtagagcttaattagatctgtctgctggggtgatccggagacgagagagctcagagctggtcccaaacatggatgagctctcagctcaagttagtagggtggtgaattttgtcagattcgaattggttagattggacttgagtgatgatcctgtctgggaagggcaaagagtaggaggaagcattgggaaggcatacacacgcttgacttgatttggcttgaagtcgagctagcaggttgctcattagccgttgtgtgatatctgaagatcaacttactacccaaacctagactcacagaaaccaattgattgatatggattaagacctg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0100400, RefSeq:Os01g0100400