BGIOSGA035856

From RiceWiki
Revision as of 08:11, 27 June 2012 by 127.0.0.1 (talk) (Created page with "{{IndicaGene| GeneName = BGIOSGA035856| Description = Putative uncharacterized protein| Definition = Oryza sativa Indica Group BGIOSGA035856, complete gene.| tag = OsI_390...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search
Gene Name

BGIOSGA035856

Description

Putative uncharacterized protein

Definition

Oryza sativa Indica Group BGIOSGA035856, complete gene.

LocusTag

OsI_39078

Ensembl Transcript ID

BGIOSGA035856-TA

Ensembl Protein ID

BGIOSGA035856-PA

Length

1188

Source

Oryza sativa Indica Group

 ORGANISM  Oryza sativa Indica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:21432002..21433189

Sequence Coding Region

21432948..21433189,21432747..21432858,21432002..21432235

Genome Context

<gbrowseImage1> name=IndicaChromosome12:21432002..21433189 source=RiceIndica12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=IndicaChromosome12:21432002..21433189 source=RiceIndica12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ATGGATCTTGAGAAGGGCAAGAAGCCATCAGAACAGGCTGCAGCCTGCAGGATTATGCAGGTCAAGGACAAGCTCATCACCCTGCAGCCTGTGGTGAGAGCTTGTGTGTTCTTGGCAACAGCAGTGGCAGCTGTGATCATGGGGCTGAACAAGCAATCCTACACAACAGTTGTCGCAATTGTGGGCACCAGGCCAGTCACACAGACCTTCACTGCAAAGTTCAAAGACACTCCTGCATTTGTGTTCTTTGTCATTGCCAATGCCATTGCCAGTGGTTATAACCTGATGGTGCTGGTGACGAGGCGCATTCTGCAACGAAGAGCGCAGAGTTTGTCTGTTCATCTTCTTGATATGGTGATCCTGACTTTGTTGGCCACCGGCTCTGCCACAGCGGCGTCGATGGCTCAGCTAGGGAAGAATGGTAACTTGCACGCACGCTGGAACCCGATATGCGACAAATTTGGTTCTTTCTGCAACCATGGAGGAATAGCACTCATGTCATCGTTCATCGGTGTTGCGCTCATGCTGGCCCTGAATCTACTGTCAGCAGCAGCCAACTCACCCCGCTCCAATGTGACCGGCCAATGA</cdnaseq>

Protein Sequence

<aaseq>MDLEKGKKPSEQAAACRIMQVKDKLITLQPVVRACVFLATAVAAVIMGLNKQSYTTVVAIVGTRPVTQTFTAKFKDTPAFVFFVIANAIASGYNLMVLVTRRILQRRAQSLSVHLLDMVILTLLATGSATAASMAQLGKNGNLHARWNPICDKFGSFCNHGGIALMSSFIGVALMLALNLLSAAANSPRSNVTGQ</aaseq>

Gene Sequence

<dnaseqindica>1..242#332..443#955..1188#ATGGATCTTGAGAAGGGCAAGAAGCCATCAGAACAGGCTGCAGCCTGCAGGATTATGCAGGTCAAGGACAAGCTCATCACCCTGCAGCCTGTGGTGAGAGCTTGTGTGTTCTTGGCAACAGCAGTGGCAGCTGTGATCATGGGGCTGAACAAGCAATCCTACACAACAGTTGTCGCAATTGTGGGCACCAGGCCAGTCACACAGACCTTCACTGCAAAGTTCAAAGACACTCCTGCATTTGTGTAAGTAAGCATTCAAGATTGTAGTTTTTCAGGTGAATTTTGATGTTGAGTGAATTGTTGAGGTTAATGATTTGTTCTTGCTTGTGCAGGTTCTTTGTCATTGCCAATGCCATTGCCAGTGGTTATAACCTGATGGTGCTGGTGACGAGGCGCATTCTGCAACGAAGAGCGCAGAGTTTGTCTGTTCATCTTCTTGATATGGTATCTGCTTCTTGTCTCAAGTGTCGGTGTTTGCTTGTTGCTTCTCCAAAATGTTAAGTTATTAGGGAGAAGCAACATATGAAGTGTCCTTTTCACTGGTAGTTTTTCATTGCGTGAGATTTCCCTCTTGGGATAGATACATTTCATTGGTTAATTGTCACTATGAAATTTTGAACTGTTTCTGATAATAGGACACATCAGTGATCAAATTATACCGAGAGAAGCAATCTAGTCCAAGTACATGATTGTTAGTTCATGTAAAATACTTACTAATCATGCTGCATAATCCAGCCAAATCTGATCAGAGAACTGAACTGAAGACATCAACTAAAAGACAACTTGAGCATAATCAAGAATCTTAGCAATTGCAACTATCAAGAACCAGTTGCTAGAGTGACTTCTGGTGCTCAACATATATGGGCTTGCACTGCAGCAAATATGACAAATATCAGACCATTGTCAGCTGACATGAGCTCATGATTCTTTTTCCCCTCTGTTCTCATTGGCCCAGGTGATCCTGACTTTGTTGGCCACCGGCTCTGCCACAGCGGCGTCGATGGCTCAGCTAGGGAAGAATGGTAACTTGCACGCACGCTGGAACCCGATATGCGACAAATTTGGTTCTTTCTGCAACCATGGAGGAATAGCACTCATGTCATCGTTCATCGGTGTTGCGCTCATGCTGGCCCTGAATCTACTGTCAGCAGCAGCCAACTCACCCCGCTCCAATGTGACCGGCCAATGA</dnaseqindica>

External Link(s)

EnsemblPlants:BGIOSGA035856